KEGG   Dechlorosoma suillum: Dsui_0166Help
Entry
Dsui_0166         CDS       T01657                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dsu  Dechlorosoma suillum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dsui_0166
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dsui_0166
Enzymes [BR:dsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dsui_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169316..170449
Genome map
AA seq 377 aa AA seqDB search
MSPTTSRTANAGRLVVKVGSALVTNNGAGLDLAAIHEWARQIAELRHNGKQVVLVSSGAI
ACGMQRLGWQKRPKAVHELQAAAAVGQMGLAQVYESAFSAHGLHTAQILLTHDDLADRKR
YLNARATLTTLLELGVVPIINENDTVVTDEIKFGDNDTLGALVANLVEADCLIILTDQPG
LFTADPRKDPSATLITSARAGDPSLEAMAGGAGTQIGTGGMITKVLAAKRAARSGADTVI
ASGREKSPLTRLATGESVGTLLVADTLPMTARKQWLADHLQLAGKLTLDQGAIQALRQGK
SLLPVGVREVHGDFERGAAVACLDESGREIARGLCNYGSSEVRLIAKHSSSDIEDILGYM
EEPELIHRDNMVCLHEK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaaccaccagtcgtacggccaatgccgggcgcctagtcgtcaaggtcggctcg
gcccttgtcaccaacaatggcgccgggctcgacctagccgccattcacgaatgggcgcgc
cagatcgccgagctccgccacaacggcaaacaggtggtcctggtttcctcaggcgccatt
gcctgcggcatgcaacgactgggctggcagaagcgccccaaggccgtgcacgaactccag
gccgccgccgccgtcggccagatgggcctggcccaggtctatgaatcggcctttagcgcc
cacggcctgcacaccgcccagattctgctgacccacgacgatctggccgaccgcaaacgc
tatctgaatgcccgggccacgctgaccacgctgctcgaactgggtgtcgtccccatcatc
aatgagaacgacacggtcgttactgacgaaatcaaattcggcgacaacgacaccctgggc
gccctggtcgccaacctggtggaggcagactgcctcatcatcctgacagaccagcccggc
ctcttcaccgccgacccgcgcaaggacccttccgccaccttgatcacctcagcccgcgcc
ggcgacccatccctggaggcaatggccggcggtgccggcacccagatcggcaccggcggc
atgattaccaaggtcctcgccgccaagcgggccgcccgcagcggcgccgacactgtcatt
gccagtggcagggaaaaaagccctctcacccgccttgctaccggagaatccgtcggcact
ctgctggtcgccgacaccctgccgatgaccgcccgcaaacagtggctggcagaccatttg
cagctggcaggaaagctgacgctcgaccagggagccatccaagccctgcgccaaggaaag
agtctgctgcctgtaggagtacgggaagttcacggcgacttcgagcggggagccgccgta
gcctgcctggacgaaagcggcagggagatcgccaggggcctctgcaattacggcagcagc
gaagttcgcctcatcgccaagcactcgtccagcgatatcgaggacatcctcggctacatg
gaagagccggaactcatccatcgcgacaacatggtctgcctgcacgagaaatag

DBGET integrated database retrieval system