KEGG   Dechlorosoma suillum: Dsui_0242Help
Entry
Dsui_0242         CDS       T01657                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dsu  Dechlorosoma suillum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dsu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dsu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(241753..243258)
Genome map
AA seq 501 aa AA seqDB search
MSGAIVAQALLDQLRAQGAAVTRLENDSRRVQPGDVFVAYPGHAADGRSFIPAALEKGAA
GVFWEARDFAWNPAWAAVPQLGVDNLQSFAGHLANLVYGRPSEQLALVGVTGTNGKTTCS
QWIAQALGGAGRSCAVIGTLGNGFPDALGEAANTTPDALALHRLLAEYKAAGAVACAMEV
SSIGLDQGRCHGARFSVAVFTNLTRDHLDYHGTMAAYGAAKERLFAWPELNEAVINLDDP
FGRELLAQTTASLRIGYTLEGRQATEADWLLSAENLRHGAEGLAFTLIAPQGRVVVETGL
VGRYNVANLLAVAGALLALGLPLETVGQRLCRLTPPAGRMQRFGGKGLPLVVVDYAHSPD
ALENALTALREVTQARGGRLHCVFGCGGDRDKGKRPLMGSVAARLADEVLLTSDNPRSED
PLAILAEIRAGAPEAALEAEREVAVAHAVLRADVADVVLVAGKGHEPYQEIMGAAGLVRR
PYSDIEAVARALQQRAGSMAA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgccatcgtggcccaggcccttctcgaccagctgcgcgcccagggcgccgcc
gtcacccggctggagaacgacagccgccgggtgcagcccggcgacgtcttcgtcgcctat
cccggccatgccgccgacggccgcagcttcattcccgccgccctggagaagggcgctgcc
ggcgtcttctgggaagcccgggactttgcctggaatcccgcctgggccgccgtgccccag
ctgggcgtggacaacctgcagtccttcgccggccatctggccaacctggtctatggccgg
ccttcggagcagctggccctggtgggcgtcaccggcaccaacggcaagaccacctgcagc
cagtggatcgcccaggccctgggcggcgccggccgctcctgcgccgtcatcggcaccctc
ggcaacggctttcccgacgccctgggcgaagccgccaacaccacgcccgacgccctggcc
ctgcaccgcctgctggccgaatacaaggctgccggcgccgtcgcctgcgccatggaagtc
tcttccatcggcctcgaccagggccgctgccacggtgcccgcttctccgtcgccgtgttc
accaacctgacccgggaccacctggactaccacggcaccatggccgcctacggcgccgcc
aaggagcggctcttcgcctggcccgagctgaacgaggcggtgatcaacctggacgatccc
ttcggccgggagctgctggcccagaccaccgccagcctgcgcatcggctataccctggaa
ggccgtcaggcgaccgaggccgactggctcctgtctgccgaaaacctgcgccatggcgcc
gaaggcctggccttcaccctgatcgcaccccagggccgggtggtggtggaaaccggcctg
gtgggccgctacaacgtggccaacctgctggccgtggccggcgccctgctggccctgggc
ctgcccctggaaaccgtgggccagcgcctgtgccgcctgaccccgcccgccggccgcatg
cagcgttttggcggcaagggcctgcccctggtggtggtggattacgcccactcccccgat
gccctggaaaacgccctgaccgccctgcgggaagtgacccaggcccggggcggccgcctg
cattgcgtcttcggctgcggcggcgaccgggacaagggcaagcgccccctcatgggcagc
gtcgccgcccgcctggccgatgaagtgctgctgaccagcgacaacccgcgcagcgaagat
cccctggcgatcctggccgagatccgtgccggagcgccggaggcggcgctggaggcggag
cgggaggtggctgtggcccacgccgtgctgcgggcggatgtggccgacgtggtgctggtg
gccggcaagggccacgagccctatcaggaaatcatgggtgccgccggcctggtgcggcgc
ccctattcggacatcgaggccgtggcgcgggccctgcaacagcgcgccgggagcatggca
gcatga

DBGET integrated database retrieval system