KEGG   Dechlorosoma suillum: Dsui_0298Help
Entry
Dsui_0298         CDS       T01657                                 

Definition
(GenBank) Kef-type K+ ransport system, predicted NAD-binding component
  KO
K10716  
voltage-gated potassium channel
Organism
dsu  Dechlorosoma suillum
Brite
Transporters [BR:dsu02000]
 Other Transporters
  Pores ion channels [TC:1]
   Dsui_0298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(299543..300421)
Genome map
AA seq 292 aa AA seqDB search
MSPAAAVHSAADSLGKPLAGWRLRLYSVVFESETRAGRLFDQCLIFAILASVAVVMADSV
HSLNARHQDLFATLEWGFTLLFTAEYLARLACLRRPWRYALSFFGLVDLLAILPTYLALL
VPEAHLLIDVRILRLLRMFRVLKLTAYLGEYQMLGSALLASRRKILVFLSVVLMIVLVMG
TLMYVVEGPANGFTSIPTAVYWAITTMTTVGFGDITPKTDVGRLISSAMMLLGWGTLAVP
TGIVTSEITAQRLQVTPTSRTCPDCLTEGLAPEAAYCQACGARLPEYRRDPA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgccgccgccgtccattccgccgccgattccctgggcaagcccctcgccggc
tggcgcctgcgcctctactcggtggtcttcgagtcggagacccgggccggtcgcctgttc
gaccagtgcctcatcttcgccatcctggccagcgtcgcggtggtcatggccgacagcgtg
catagcctcaacgcccgccaccaggacctcttcgccaccctggagtggggcttcaccctg
ctgttcaccgccgaatacctggcccgcctggcctgtctgcgccggccctggcgctatgcc
ctgagcttcttcggcctggtggacctgctggccatcctgcccacctacctggcgctgctg
gtgcccgaggcccacctgctcatcgacgtgcgcatcctgcgcctgctgcgcatgttccgg
gtgctcaagctcaccgcctacctgggcgagtaccagatgctgggcagcgccctgctggcc
agccgacgcaagatcctggtgttcctctcggtggtgctgatgatcgtgctggtcatgggc
accctgatgtatgtggtggaaggcccggccaacggcttcacaagcattcccaccgccgtc
tattgggccatcaccaccatgaccaccgtcggcttcggcgacatcacgcccaagaccgac
gtgggccgtctcatctcctcggccatgatgctgctcggctggggcaccctggcggtgccc
accggcatcgtcacctccgagatcaccgcccagcgcctgcaggtcacgcccaccagccgc
acctgtccggactgcctgaccgaagggctggcgccggaggccgcctactgccaggcctgc
ggcgcccgtctgccggaataccggcgcgatccggcctga

DBGET integrated database retrieval system