KEGG   Dechlorosoma suillum: Dsui_0485Help
Entry
Dsui_0485         CDS       T01657                                 

Definition
Holliday junction DNA helicase, RuvA subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dsu  Dechlorosoma suillum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dsui_0485
Enzymes [BR:dsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dsui_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(488744..489328)
Genome map
AA seq 194 aa AA seqDB search
MIGRLTGLLAEKNPPQVVLDVQGVGYEVDVPMSTFYNLPGNGDKVTLLTHFVVREDGHFL
FGFLTEAERFAFRQLIKISGVGPRMALAILSGLSVSDLAAAISRQESGRLTKVPGIGKKT
AERLLLELKDKLAPVVGGGAAAALVVHDDQSDILNALLALGYNEREAAAALKQLPAGSGV
SDGIRQALKLLAKP
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaagactcaccggcctcctggccgaaaagaatcccccccaggtggtcctggac
gtgcagggcgtcggctacgaggtggatgtgcccatgagcaccttctacaacctaccgggc
aacggcgacaaggtgaccctgctgacccacttcgtggtgcgggaggacggccattttctc
ttcggcttcctcaccgaggcggagcgtttcgccttccgccagctgatcaagatttccggc
gtcggcccccgcatggccctggccattctttccggcctttccgtcagcgacctggcggcg
gccatctcccgccaggagtccggccgcctgaccaaggtgccgggcatcggcaagaagact
gccgagcgcctgctgctggagctgaaggacaagctggccccggtggtgggcggcggggcc
gctgcggccctggtggtgcacgacgaccagtcggacatcctcaatgcgctgctggccctg
ggttacaacgagcgggaagccgccgccgccctcaagcaattgcccgccggcagcggcgtt
tccgatggcatccgccaggccctcaaactgctggccaagccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system