KEGG   Dechlorosoma suillum: Dsui_0485Help
Entry
Dsui_0485         CDS       T01657                                 

Definition
Holliday junction DNA helicase, RuvA subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dsu  Dechlorosoma suillum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dsu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(488744..489328)
Genome map
AA seq 194 aa AA seqDB search
MIGRLTGLLAEKNPPQVVLDVQGVGYEVDVPMSTFYNLPGNGDKVTLLTHFVVREDGHFL
FGFLTEAERFAFRQLIKISGVGPRMALAILSGLSVSDLAAAISRQESGRLTKVPGIGKKT
AERLLLELKDKLAPVVGGGAAAALVVHDDQSDILNALLALGYNEREAAAALKQLPAGSGV
SDGIRQALKLLAKP
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaagactcaccggcctcctggccgaaaagaatcccccccaggtggtcctggac
gtgcagggcgtcggctacgaggtggatgtgcccatgagcaccttctacaacctaccgggc
aacggcgacaaggtgaccctgctgacccacttcgtggtgcgggaggacggccattttctc
ttcggcttcctcaccgaggcggagcgtttcgccttccgccagctgatcaagatttccggc
gtcggcccccgcatggccctggccattctttccggcctttccgtcagcgacctggcggcg
gccatctcccgccaggagtccggccgcctgaccaaggtgccgggcatcggcaagaagact
gccgagcgcctgctgctggagctgaaggacaagctggccccggtggtgggcggcggggcc
gctgcggccctggtggtgcacgacgaccagtcggacatcctcaatgcgctgctggccctg
ggttacaacgagcgggaagccgccgccgccctcaagcaattgcccgccggcagcggcgtt
tccgatggcatccgccaggccctcaaactgctggccaagccctga

DBGET integrated database retrieval system