KEGG   Dechlorosoma suillum: Dsui_0498Help
Entry
Dsui_0498         CDS       T01657                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dsu  Dechlorosoma suillum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dsu00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
500379..500987
Genome map
AA seq 202 aa AA seqDB search
MSGHLYIVTAPSGAGKTTLVRLLLQNDPAIGLSVSHTTRAPRTGEENGQAYHFTDVADFL
ARVDRGEFLEWAEVHGNYYGTSRTWIEQQLTSGRDVLLEIDWQGAQQVRKVFGDAIGVFI
LPPSMEELARRLAGRGTDSEDVIARRLAAARDEMRHVGEFDYVIINNDLQTALSDLLAVV
RATRLKLPVQQERHASLFASLL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccatctctacatcgtcaccgccccctccggcgccggcaagaccaccctggtc
cgcctgctgctgcagaacgacccggccatcggcctctccgtctcccacaccacccgggcg
ccccgcaccggggaggagaacggccaggcctaccacttcaccgacgtggccgatttcctg
gcccgggtggaccggggcgaattcctcgaatgggccgaggtgcacggcaactactacggc
acctcccgcacctggatcgaacagcagctgacctccggccgcgacgtgctgctggagatc
gactggcagggcgcccagcaggtgcgcaaggtgttcggcgacgccatcggcgtcttcatc
ctgccgccctccatggaagaactggcccgccgcctggccggccgcggcaccgacagcgag
gacgtcatcgcccgccgtctggccgccgcccgcgacgagatgcggcatgtgggcgaattc
gactatgttattattaacaacgacctgcagacggccctcagcgacctgctggccgtggtg
cgcgcaacgcgcttgaagcttcccgtgcagcaggaacgccacgcttcgctgttcgcctcg
ctgctctaa

DBGET integrated database retrieval system