KEGG   Dechlorosoma suillum: Dsui_0498Help
Entry
Dsui_0498         CDS       T01657                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00230  Purine metabolism
dsu01100  Metabolic pathways
Module
dsu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dsui_0498
Enzymes [BR:dsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dsui_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 MMR_HSR1 AAA_22 cobW DUF5053 AAA_30 ABC_tran RsgA_GTPase NTPase_1 AAA
Motif
Other DBs
NCBI-ProteinID: AEV24912
UniProt: G8QFA2
Position
500379..500987
Genome map
AA seq 202 aa AA seqDB search
MSGHLYIVTAPSGAGKTTLVRLLLQNDPAIGLSVSHTTRAPRTGEENGQAYHFTDVADFL
ARVDRGEFLEWAEVHGNYYGTSRTWIEQQLTSGRDVLLEIDWQGAQQVRKVFGDAIGVFI
LPPSMEELARRLAGRGTDSEDVIARRLAAARDEMRHVGEFDYVIINNDLQTALSDLLAVV
RATRLKLPVQQERHASLFASLL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagcggccatctctacatcgtcaccgccccctccggcgccggcaagaccaccctggtc
cgcctgctgctgcagaacgacccggccatcggcctctccgtctcccacaccacccgggcg
ccccgcaccggggaggagaacggccaggcctaccacttcaccgacgtggccgatttcctg
gcccgggtggaccggggcgaattcctcgaatgggccgaggtgcacggcaactactacggc
acctcccgcacctggatcgaacagcagctgacctccggccgcgacgtgctgctggagatc
gactggcagggcgcccagcaggtgcgcaaggtgttcggcgacgccatcggcgtcttcatc
ctgccgccctccatggaagaactggcccgccgcctggccggccgcggcaccgacagcgag
gacgtcatcgcccgccgtctggccgccgcccgcgacgagatgcggcatgtgggcgaattc
gactatgttattattaacaacgacctgcagacggccctcagcgacctgctggccgtggtg
cgcgcaacgcgcttgaagcttcccgtgcagcaggaacgccacgcttcgctgttcgcctcg
ctgctctaa

DBGET integrated database retrieval system