KEGG   Dechlorosoma suillum: Dsui_0596Help
Entry
Dsui_0596         CDS       T01657                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dsu  Dechlorosoma suillum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dsui_0596
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dsui_0596
Enzymes [BR:dsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dsui_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592877..593860
Genome map
AA seq 327 aa AA seqDB search
MAEMLTQSRLNPQLDAEGKLQHLLSTEGLPLPVITQILDTAESFLEVSDRDVKKVPLLRG
KSVFNLFFENSTRTRTTFEIAAKRLSADVINLDVSRSSTAKGETLLDTIDNLCSMHADMF
VVRHATSGAPFLIAEHLKRIGRDDIHVVNAGDGRHAHPTQGLLDMYTIRHYKKDFSNLTV
AIVGDILHSRVARSDLHALRTLGCGEIRAIAPKTLLPGYLEQLGVKVFHDMNEGLKDCDV
VIMLRLQNERMNGALLPSAGEYFKRYGLTPEKLALAKPDAIVMHPGPMNRGVEIDSSVAD
GPQAVILNQVTFGIAVRMAVMGILAGN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagatgctcacccagagccgtctgaatccgcagctcgacgccgagggcaagctg
cagcacctgctgtccaccgagggcctgcccctgccggtgatcacccagatcctggacacc
gccgagagcttcctcgaggtctcggaccgggacgtgaagaaggtgcccctgctgcgcggc
aagagcgtcttcaacctcttcttcgagaactccacccgtacccgcaccaccttcgagatc
gccgccaagcgcctctcggcggacgtcatcaacctggatgtatcccgctcctccacggcc
aagggcgagaccctgctcgacaccatcgacaacctctgctccatgcacgccgacatgttc
gtggtgcgccacgccacctccggcgcccccttcctcatcgccgagcacttgaagcgcatc
ggccgggacgacatccacgtggtgaacgccggtgacggccgccatgcccaccccacccag
gggctgctggacatgtacaccatccgccactacaagaaggatttctccaacctgacggtg
gccatcgtcggcgacatcctccattcccgggtcgcccgctccgacctgcatgccctgcgc
accctgggctgcggcgaaatccgcgccatcgcgccgaagaccctgctgcccggctatctg
gaacagctgggggtgaaggtcttccacgacatgaacgaaggcctcaaggactgcgacgtg
gtgatcatgctgcgcctgcagaatgaacgcatgaacggggccctgctgccctccgccggc
gagtatttcaagcgctacggcctgacgccggaaaagctggccctggccaagcccgacgcc
atcgtcatgcacccgggccccatgaaccggggcgtggaaatcgactcgtccgtggccgac
gggccccaggcggtgatcctcaaccaggtcactttcggcatcgccgtgcgcatggcggtg
atgggcatcctcgcggggaactga

DBGET integrated database retrieval system