KEGG   Dechlorosoma suillum: Dsui_0671Help
Entry
Dsui_0671         CDS       T01657                                 

Definition
(GenBank) arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00220  Arginine biosynthesis
dsu00330  Arginine and proline metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01130  Biosynthesis of antibiotics
dsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Dsui_0671
   00330 Arginine and proline metabolism
    Dsui_0671
Enzymes [BR:dsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dsui_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEV25080
UniProt: G8QGK1
Position
complement(669289..670167)
Genome map
AA seq 292 aa AA seqDB search
MHRTLRLIGAASGVGAQDPGCHAGPTALHRAHAFDDLQRRPDLSWGETLFPRQALGGRVA
EVADLCQRLAEAVRQARERGETPVVLGGDHSCAIGTWSGVRAASPAPVGLLWLDAHLDSH
TPESTHSGALHGMPLACLLGQGDRRLVTVGGPGPKLLPGHVALIGVRSYEPEEREFLDRL
GVRVFTIDEVRQRGLPAVFGEALARVRQAPGGYGVSLDLDVFDPREAPGVGSPEPAGLSQ
TELMPALAGLAGDPALLALEVMEFNPDRDAGGRTAALLARLIGAVFPRRHGA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcactctccgcctcattggtgccgccagcggcgtcggcgcccaggacccgggc
tgccacgccggccccaccgccctgcaccgggcccacgctttcgacgacctgcagcgccgc
cccgatctcagctggggcgaaaccctctttccgcgccaggccctgggcggccgcgtggcc
gaggtggccgacctctgccagcgcctggccgaggcagtgcgccaggcccgggagcggggc
gagaccccggtggtgctgggcggcgaccattcctgcgccatcggcacctggagcggcgtc
cgcgccgccagcccggcgcccgtcggcctgctctggctcgacgcccatctggacagccat
acccccgaaagcacccattccggcgccctccacggcatgcccctggcctgcctgctgggc
cagggcgaccggcgtctggtgaccgtgggcggccccgggcccaagctgctgcccgggcat
gtggccctcatcggggtgcgcagctacgagccggaggagcgggaattcctcgaccgcctc
ggggtgcgcgtgttcaccattgacgaggtgcggcagcggggcctgccggcggtcttcggc
gaagccctggcccgggtgcgacaggcgcccggcggctacggcgtcagcctggacctggac
gtcttcgatccccgggaagcgccgggggtgggcagcccggaaccggcgggcctgtcccag
accgaactgatgccggccttggccggcctggccggggacccggccctgctggccctggag
gtgatggagttcaacccggaccgggatgcgggcgggcgtacggcagccctgctggcccgg
ctcatcggtgccgtcttcccccgccggcatggggcctga

DBGET integrated database retrieval system