KEGG   Dechlorosoma suillum: Dsui_0882Help
Entry
Dsui_0882         CDS       T01657                                 

Definition
nitrous oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
dsu  Dechlorosoma suillum
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Dsui_0882
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Dsui_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893538..895835
Genome map
AA seq 765 aa AA seqDB search
MKPQKPIAAFLAAALGIGALWAGSAAGAESLQDVMKRRNLSQQDLLAAAKTYVPTGKRDE
FVAFSSGGQSGQVIVYGIPSMRILKYIGVFTPEPWQGYGYDEESKAVLAQGRIDGRDITW
GDTHHPAMSETQGKYDGQFLFINDKANPRLAVIDLRDFETKQIVANPIFRSEHGGAFVTP
NTEYIIEAAQYAAPLDNKKFVPLEEFNEKYRGGVTYWKFDRKEGRIQTKDSFSVELPPYS
QDLSDAGKGPSDGWSFTNSFCSERYVGGIEKGRPPYEAGCSAKDTDYMHVVNWKKAAELV
AKGMAKKINGHNVLSIETAVKEGILFLIPEPKSPHGVMVSPDGKFITVSGKLDTHVIVYS
WEKIQAAIKAGNFEAKDAYGIPVLGMKETLHKTVQVGLGPLHTQYDSKSCVAYTSLYVDS
QIAKWDYCEGRVLDKIAVHYNVGHLMTMEGDSMDPKGRYLVAMNKLSIDRFTPVGPLHPQ
NHQLIDISNDKMQLLYDMPIPLGEPHYVVAIDAAKLKPGVRYKVGTNSRTDAPSAGAVRA
GEEKTVRKGNKIEVFGTLIRSHITPETIEAEVGDEITIHLTNLERAQDETHGFTVSTYNV
HASVEPGKTVTVKLKADKEGVYPYYCTEFCSALHLEMQGYLLVKPKGWKATKTAGAEKAI
YSEDDYKKQLKKVADTQAVIDQVVGYITSVNYKDFPDVVNMMDDAVDQLNKIKDAKAKHE
DAARKKDWNQATLWAEQVWQYQVKAADLGLRAKTYLEQNGARKGK
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcaaaaacccattgcggcctttctcgccgcagccctgggcatcggcgccctg
tgggccggctctgccgccggggccgagtccttgcaggacgtgatgaagcgccgcaacctg
tcccagcaggacctgctggcggcggccaagacctatgtgccgacgggcaagcgcgacgag
ttcgtcgccttctcctccggcggccagtccggccaggtgatcgtgtatggcattccctcc
atgcgcatcctcaagtacatcggcgtgttcacccccgagccctggcagggctacggctac
gacgaggaatccaaggcggtgctggcccagggcaggatcgacggtcgcgacatcacctgg
ggcgacacccaccacccggccatgtccgagacccagggcaagtacgacggccagttcctc
ttcatcaacgacaaggccaatccgcgcctggcggtgatcgacctgcgggacttcgagacc
aagcagatcgtcgccaaccccattttccgttccgagcacggcggcgccttcgtcaccccc
aataccgagtacatcatcgaggcggcccagtacgcggcccccctggacaacaagaagttc
gtgcccctggaagagttcaacgagaagtaccggggcggcgtcacctactggaagttcgac
cgcaaggaaggccgcatccagaccaaggattccttctccgtcgaactgccgccctacagc
caggatctctccgacgccggcaaggggccgtccgacggctggtccttcaccaactccttc
tgttccgagcgctacgtcggcggcatcgagaagggccgcccgccctatgaagccggctgt
tccgccaaggacaccgactacatgcacgtggtgaactggaagaaggccgccgaactggtg
gccaagggcatggccaagaagatcaacggccacaacgtgctctccatcgagacggcggtg
aaggaaggcatcctcttcctcattcccgaacccaagtcgccccacggcgtcatggtttcg
ccggatggcaaattcatcaccgtctccggcaagctggacacccacgtcatcgtctattcc
tgggagaagatccaggccgccatcaaggccggcaacttcgaggccaaggatgcctacggc
atcccggtgctgggcatgaaagagaccttgcacaagaccgtgcaggtgggcctgggcccg
ttgcatacccagtacgactccaagtcgtgcgtcgcctatacctccctctatgtggacagc
cagatcgccaagtgggactactgcgagggccgggtgctggacaagatcgcggtgcattac
aacgtgggccacctgatgaccatggaaggcgattccatggaccccaagggccgctatctg
gtggccatgaacaagctctccatcgaccgcttcaccccggtgggccccctgcatccgcag
aatcaccagctgatcgacatcagcaacgacaagatgcagctcctgtacgacatgcccatc
cccctgggtgagccccactacgtcgtcgccatcgatgccgccaagctgaagcccggcgtg
cgctacaaggtgggcaccaacagccgcaccgatgcgcccagtgccggtgccgtgcgggcc
ggtgaagagaagacggtgagaaagggcaacaagatcgaggtcttcggcaccctgatccgc
tcccacatcaccccggaaaccatcgaggccgaggtgggcgacgaaatcaccatccacctg
accaacctggaacgggcccaggacgagacccacggcttcaccgtctccacctacaacgtc
cacgcttccgtcgagccgggcaagaccgtcacggtgaaactgaaggccgacaaggaaggc
gtctatccctactactgcaccgagttctgctccgcgctgcacctggaaatgcagggctac
ctcctggtcaagccgaagggctggaaggcgaccaagaccgctggtgccgagaaggcgatc
tacagcgaagacgactacaagaagcagctgaagaaggtggccgatacccaggccgtcatc
gatcaggtggtcggctacatcacctccgtgaattacaaggacttcccggatgtggtgaac
atgatggacgacgccgtcgatcaactgaacaagatcaaggacgccaaggccaagcatgaa
gacgccgccaggaagaaggactggaaccaggccaccctgtgggccgagcaagtctggcag
taccaggtgaaggcagctgacctcggcctgcgcgccaagacctatctggaacagaacggc
gcccgcaaaggcaagtag

DBGET integrated database retrieval system