KEGG   Dechlorosoma suillum: Dsui_1034Help
Entry
Dsui_1034         CDS       T01657                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dsu  Dechlorosoma suillum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dsui_1034
Enzymes [BR:dsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Dsui_1034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1067008..1067859
Genome map
AA seq 283 aa AA seqDB search
MNPAWTWDSAYPAPAKLNLFLHVVGCRADGYHLLQTLFRFVDYGDTLHFAPREDGQVRLL
NPLPGVPEESDLTVRAARLLQQAANCTRGADIRLEKRLPMGGGLGGGSSDAATVLLALNH
LWQLGLSRERLQALGLTLGADVPVFIFGRTAFAEGVGEALQAVPAAPAWYLVLQPPVAVP
TVDIFRAPELKRDTPVMAAADWRPGLGGNDLEPVACARFPEVARHLAWLQHFGRARMSGS
GACVFAEFPEQAGAEAALAQLPPDMRGWVAPGLDSHPLYGLLP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggcctggacctgggacagcgcctacccggcgccagccaagctcaatctcttc
ctgcacgtggtgggctgccgcgccgacggctatcacctgctgcagaccctgttccgtttc
gtcgattacggcgacaccctgcacttcgcgccccgggaggacggccaggtgcgcctgctc
aatcccctgcccggggtgccggaggagagcgacctgaccgtgcgggccgcccgtctcctg
cagcaggcggctaactgcacccggggggcggatatccgcctggagaagcggctgcccatg
ggcggcggcctgggcggcggcagttccgacgccgccaccgtgctgctggccctcaaccac
ctgtggcaactgggcctgtcccgggaacggttgcaggccctgggcctgaccctgggggcc
gatgtgccggtcttcatcttcggccgcaccgccttcgccgagggcgtgggcgaggcgctg
caggccgtgccggcggcgccggcctggtatctggtgctgcagccgccggtggcggtgccc
accgtggacatcttccgggctcccgagctgaagcgggacacgccggtcatggcggcggcc
gattggcggcccggcctgggcggcaacgacctggagccggtggcctgcgcccgctttccc
gaggtggcgcggcacctggcatggctgcagcatttcggccgggcccgcatgagcggctcc
ggggcctgcgtctttgccgaattcccggagcaggccggggccgaggcggccctggcccag
ctgccgcccgacatgcggggctgggtggcgccagggctggacagccaccccctgtacgga
ctgttgccctag

DBGET integrated database retrieval system