KEGG   Dechlorosoma suillum: Dsui_1119Help
Entry
Dsui_1119         CDS       T01657                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dsu  Dechlorosoma suillum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dsui_1119
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dsui_1119
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dsui_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1166994..1167482
Genome map
AA seq 162 aa AA seqDB search
MTTVFDFSVRRADGSQQSLADYRGQVLLIVNTASRCGFTPQYAGLEALYRRYREQGLTVL
AFPCNQFGAQEPGSAEEIASFCSLNYDVSFPVFARIEVNGPQADPLFRWLKQEQPGWLGT
AAIKWNFTKFLVDRQGRAVGRYGPMTKPEALARAIEARLALP
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgtcttcgatttttccgtccgccgtgccgacggcagccagcagtccctggcc
gattaccgggggcaggtgctgctcatcgtcaatacggccagccgttgcggcttcacgccc
cagtatgcgggtctggaggccctttaccggcgctaccgggagcagggcctgacggtgctg
gcctttccctgcaaccagttcggcgcccaggagccgggcagcgccgaggagatcgccagt
ttctgctccctcaactacgacgtcagctttcccgtcttcgcccgtatcgaggtcaacggt
ccccaggccgatccgctcttccgctggctcaagcaggagcagcccggctggctcggcacg
gccgcgatcaagtggaatttcaccaagttcctggtggaccggcagggccgggcggtgggg
cgctatgggcccatgaccaagccggaagccctggcccgggccattgaggcccgcctggcg
ctgccgtga

DBGET integrated database retrieval system