KEGG   Dechlorosoma suillum: Dsui_1125Help
Entry
Dsui_1125         CDS       T01657                                 

Definition
Malonyl-CoA decarboxylase (MCD)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
dsu  Dechlorosoma suillum
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dsui_1125
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dsui_1125
Enzymes [BR:dsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Dsui_1125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1173738..1175066
Genome map
AA seq 442 aa AA seqDB search
MATTPSKTAAALPAKQLARIREQLKECAASLGGEVSARARAAQLAETYLGLDDGGRHEFL
RLIALEFGPDPKRVATAHSAYQQAVGSPAQWDAEAALRAAMRSSRIRILTQFNAIPQGVK
FLVDLRADLLRFLDKDPELKALDRELENRLTSWFDVGFLEISRLTWQAPAALLEKLIQYE
AVHEIRSWKDLKNRLDSDRRCYAFFHPRMPVEPLIFVEVALVNKLSDSVQHLLDEDAPTA
DPHRADTAIFYSISNTQVGLRGVSFGNFLLKRVIDDLKRDFPRLKTFATLSPLPTLRLWA
DRNPEVFAACFAPDLAKIAKHAGIEPDADALRALLPKGEWAADARLARLIEPGLVRLAAR
YLLTGKSGDKPFDPVARFHLGNGARVERLNFLADTAAKGFKQSYGMMVNYLYEPDDLEAN
VDAFVREGRLAAVAAVRHAAKG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacccccagcaaaaccgctgccgccctgccagccaaacagctggcccgcatc
cgcgaacaactgaaggaatgtgccgccagcctgggcggcgaagtctccgcccgggcccgg
gccgcccaattggcggaaacctacctcggtctggacgatggggggcgccatgaattcctg
cgcctcatcgccttggagttcggccccgatcccaagcgcgtcgccaccgcccacagcgcc
taccagcaggccgtcggcagccccgcccagtgggatgcggaagccgccctgcgggccgcc
atgcgttcttcccgcatccgcatcctgacccagttcaatgccattccccagggcgtgaaa
ttcctggtggacctgcgggccgacctgctgcgcttcctcgacaaggacccggaactgaag
gccctggaccgggagctggagaaccgcctcacctcctggttcgacgtcggcttcctggaa
atttcccgcctcacctggcaggccccggcggccctgctggaaaagctgatccagtacgaa
gcggtgcacgagatccgctcttggaaggacctgaagaaccgtctcgactcggaccggcgc
tgctacgcctttttccacccgcgcatgccggtggagcccctcatcttcgtcgaagtggcc
ctggtcaataagctctccgactcggtgcaacacctgctggacgaggacgctcccaccgcc
gacccgcaccgggccgacaccgccattttctattccatctccaacacccaggtgggcctg
cgcggcgtctccttcggcaacttcctgctgaagcgggtgatcgacgacctcaagcgggac
ttcccccgcctcaagaccttcgccaccctttcacccctgcccaccctgcgcctgtgggcc
gaccgcaacccggaagtgttcgccgcctgcttcgcgcccgatctggccaagatcgccaag
catgccggcatcgaacccgacgccgatgccctgcgggccctgctgcccaagggcgaatgg
gctgcagatgcccgtctggcgaggctcatcgagccgggcctggtgcgtctggccgcccgc
tacctgctcaccggcaagtccggcgacaagcccttcgacccggtggcccgcttccacctg
ggcaacggcgcccgggtggagcgcctcaacttcctcgccgacaccgccgccaagggcttc
aaacagtcctacggcatgatggtgaactacctgtacgaaccggacgacctggaagccaac
gtggacgccttcgtccgcgaaggccgtctggcggcggtggcggcggttagacatgcggcg
aaggggtag

DBGET integrated database retrieval system