KEGG   Dechlorosoma suillum: Dsui_1125Help
Entry
Dsui_1125         CDS       T01657                                 

Definition
Malonyl-CoA decarboxylase (MCD)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
dsu  Dechlorosoma suillum
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dsu00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dsu00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1173738..1175066
Genome map
AA seq 442 aa AA seqDB search
MATTPSKTAAALPAKQLARIREQLKECAASLGGEVSARARAAQLAETYLGLDDGGRHEFL
RLIALEFGPDPKRVATAHSAYQQAVGSPAQWDAEAALRAAMRSSRIRILTQFNAIPQGVK
FLVDLRADLLRFLDKDPELKALDRELENRLTSWFDVGFLEISRLTWQAPAALLEKLIQYE
AVHEIRSWKDLKNRLDSDRRCYAFFHPRMPVEPLIFVEVALVNKLSDSVQHLLDEDAPTA
DPHRADTAIFYSISNTQVGLRGVSFGNFLLKRVIDDLKRDFPRLKTFATLSPLPTLRLWA
DRNPEVFAACFAPDLAKIAKHAGIEPDADALRALLPKGEWAADARLARLIEPGLVRLAAR
YLLTGKSGDKPFDPVARFHLGNGARVERLNFLADTAAKGFKQSYGMMVNYLYEPDDLEAN
VDAFVREGRLAAVAAVRHAAKG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacccccagcaaaaccgctgccgccctgccagccaaacagctggcccgcatc
cgcgaacaactgaaggaatgtgccgccagcctgggcggcgaagtctccgcccgggcccgg
gccgcccaattggcggaaacctacctcggtctggacgatggggggcgccatgaattcctg
cgcctcatcgccttggagttcggccccgatcccaagcgcgtcgccaccgcccacagcgcc
taccagcaggccgtcggcagccccgcccagtgggatgcggaagccgccctgcgggccgcc
atgcgttcttcccgcatccgcatcctgacccagttcaatgccattccccagggcgtgaaa
ttcctggtggacctgcgggccgacctgctgcgcttcctcgacaaggacccggaactgaag
gccctggaccgggagctggagaaccgcctcacctcctggttcgacgtcggcttcctggaa
atttcccgcctcacctggcaggccccggcggccctgctggaaaagctgatccagtacgaa
gcggtgcacgagatccgctcttggaaggacctgaagaaccgtctcgactcggaccggcgc
tgctacgcctttttccacccgcgcatgccggtggagcccctcatcttcgtcgaagtggcc
ctggtcaataagctctccgactcggtgcaacacctgctggacgaggacgctcccaccgcc
gacccgcaccgggccgacaccgccattttctattccatctccaacacccaggtgggcctg
cgcggcgtctccttcggcaacttcctgctgaagcgggtgatcgacgacctcaagcgggac
ttcccccgcctcaagaccttcgccaccctttcacccctgcccaccctgcgcctgtgggcc
gaccgcaacccggaagtgttcgccgcctgcttcgcgcccgatctggccaagatcgccaag
catgccggcatcgaacccgacgccgatgccctgcgggccctgctgcccaagggcgaatgg
gctgcagatgcccgtctggcgaggctcatcgagccgggcctggtgcgtctggccgcccgc
tacctgctcaccggcaagtccggcgacaagcccttcgacccggtggcccgcttccacctg
ggcaacggcgcccgggtggagcgcctcaacttcctcgccgacaccgccgccaagggcttc
aaacagtcctacggcatgatggtgaactacctgtacgaaccggacgacctggaagccaac
gtggacgccttcgtccgcgaaggccgtctggcggcggtggcggcggttagacatgcggcg
aaggggtag

DBGET integrated database retrieval system