KEGG   Dechlorosoma suillum: Dsui_1166Help
Entry
Dsui_1166         CDS       T01657                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dsu  Dechlorosoma suillum
Brite
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Dsui_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1222464..1223474
Genome map
AA seq 336 aa AA seqDB search
MFQLKITPTAIVLAATLGLAGLAQAAGNEPIQPIKPAKVANPALVELGKKLYFDPRLSMS
GFISCNSCHNLSMGGTDNIKTSIGHNWNEGPINAPTVLNSSLNVAQFWDGRAADLKAQAG
GPIANPGEMASNHTLAVDVVKSIPGYVAEFKKAFGSDKVDIDGITKAIAAFEETLVTPNS
RFDKWLKGDQKALSKNELEGYKLFKDSGCVACHNGPAVGGNSFQKMGVVEPYKASSAAEG
RVAVTGKDADRFNFKVPTLRNVEMTYPYFHDGAANTLKEAVDTMGRIQLGKKFTDEENAK
IVAFLKTLTGDQPSFKLPILPPSADATPRPQPFGKK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttccaactcaagatcacgccgaccgccatcgtcctggcggccaccctgggccttgcc
ggcctggcgcaagccgccggcaacgagcccatccagccgatcaagcccgccaaggtggcc
aaccccgccctggtggaactgggcaagaagctgtatttcgacccccggctgtccatgtcc
ggcttcatttcctgcaattcctgccacaacctgtccatgggcggcacggacaacatcaag
acctccatcggccacaactggaacgaaggtcccatcaacgcgcccaccgtgcttaattcc
agcctcaacgtggcccagttctgggacggccgtgcggccgacctcaaggcccaggccggc
ggccccatcgccaacccgggtgaaatggcctccaaccacaccctggcggtggacgtggtg
aagtccattcccggctacgtggccgagttcaagaaggccttcggctccgacaaggtggat
atcgacggcatcaccaaggccatcgctgccttcgaggaaaccctggtgacccccaattcc
cgcttcgacaagtggctgaagggcgaccagaaggccctgagcaagaacgaactggaaggc
tacaagctgttcaaggacagcggctgcgtcgcctgccacaacggcccggccgtgggcggc
aactccttccagaagatgggcgtggtggaaccgtacaaggcttccagcgccgccgaaggc
cgggtcgccgtgaccggcaaagatgcggaccgcttcaacttcaaggtgccgaccctgcgc
aacgtggaaatgacctacccctacttccacgacggcgccgccaacaccctgaaggaagcg
gtggacaccatgggccgcatccagctgggcaagaagttcacggacgaggaaaacgccaag
atcgtggccttcctgaagaccctgaccggcgaccagcccagcttcaagctgccgatcctg
ccgccgtctgccgacgccaccccgcgtccccagccgttcggcaagaagtaa

DBGET integrated database retrieval system