KEGG   Dechlorosoma suillum: Dsui_1445Help
Entry
Dsui_1445         CDS       T01657                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00020  Citrate cycle (TCA cycle)
dsu00640  Propanoate metabolism
dsu00660  C5-Branched dibasic acid metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
dsu01130  Biosynthesis of antibiotics
dsu01200  Carbon metabolism
Module
dsu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dsu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsui_1445
   00640 Propanoate metabolism
    Dsui_1445
   00660 C5-Branched dibasic acid metabolism
    Dsui_1445
Enzymes [BR:dsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dsui_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEV25840
UniProt: G8QNJ5
Position
1500292..1501452
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILRKFGVTTPRGKPAFSVDEAVKVAEELGGKVWVVKAQIHAGGRGKGGGV
KVAKSLDEVRQYATQILGMQLVTHQTGPEGQKVRRLLIEEGADIKKEYYLAVLTDRATQK
VAVMASSEGGMDIEEVAHATPEKILKEFVDPLVGITDQQTLNLAQGIGVPADSVAKAQAE
IKKLYQCYMETDASLAEINPLILEGNGNIKALDAKFNFDSNALFRHPEIVEYRDLDEEDA
DEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGAEPANFLDVGGGATTEKVTE
AFKIMLKNPKVKGILVNIFGGIMKCDTIATGVVTAAKEVNLSVPLVVRMKGTNEDLGKQI
LKDSGLPIISADTMAEAAQKIVDAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaatatcagggtaaggagatcctgagaaagttcggcgtgacgacgccg
cgcggcaagcctgccttctccgtcgacgaagctgtcaaggtcgccgaggaactgggcggc
aaggtgtgggtcgtgaaggcccagattcacgctggtggccgcggcaagggcggtggcgtg
aaggttgccaagtccctggatgaagtgcgccaatacgccacccagattctgggcatgcaa
ctggtgacccaccagaccggcccggaaggccagaaggtccgccgcctgctgattgaagaa
ggcgccgacatcaagaaggaatactacctggctgtcctgaccgaccgcgctacccagaag
gtcgccgtcatggcctcctccgaaggcggcatggacatcgaggaagtggcccacgccacc
cccgagaagatcctcaaggaattcgttgatcccctggtcggcatcaccgaccagcagacc
ctgaacctggcccagggcatcggcgttcccgccgactccgtggccaaggcccaggccgag
atcaagaagctgtaccagtgctacatggaaactgatgcttccctggcggaaatcaacccg
ctgatcctggaaggcaacggcaacatcaaggctctggacgccaagttcaacttcgactcc
aacgccctcttccgtcatcccgaaatcgtcgaataccgcgatctggatgaagaagacgcc
gacgaaatcgaagcctccaagttcgacctggcctacatctccctggacggcaacatcggc
tgtctggtgaacggtgccggtctggccatggccaccatggacaccatcaagctgttcggc
gccgagccggccaacttcctggacgtgggcggcggcgccaccaccgagaaggtcaccgaa
gccttcaagatcatgctcaagaaccccaaggtcaagggcatcctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtggtgaccgcggccaaggaagtgaac
ctgtccgtgccgctggtggtccgcatgaagggcaccaacgaggacctgggcaagcagatc
ctgaaggattccggtctgccgatcatttccgccgataccatggccgaagcggcccagaag
atcgtcgacgcggtcaagtaa

DBGET integrated database retrieval system