KEGG   Dechlorosoma suillum: Dsui_1445Help
Entry
Dsui_1445         CDS       T01657                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dsu  Dechlorosoma suillum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsui_1445
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsui_1445
   00640 Propanoate metabolism
    Dsui_1445
   00660 C5-Branched dibasic acid metabolism
    Dsui_1445
Enzymes [BR:dsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dsui_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1500292..1501452
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILRKFGVTTPRGKPAFSVDEAVKVAEELGGKVWVVKAQIHAGGRGKGGGV
KVAKSLDEVRQYATQILGMQLVTHQTGPEGQKVRRLLIEEGADIKKEYYLAVLTDRATQK
VAVMASSEGGMDIEEVAHATPEKILKEFVDPLVGITDQQTLNLAQGIGVPADSVAKAQAE
IKKLYQCYMETDASLAEINPLILEGNGNIKALDAKFNFDSNALFRHPEIVEYRDLDEEDA
DEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGAEPANFLDVGGGATTEKVTE
AFKIMLKNPKVKGILVNIFGGIMKCDTIATGVVTAAKEVNLSVPLVVRMKGTNEDLGKQI
LKDSGLPIISADTMAEAAQKIVDAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaatatcagggtaaggagatcctgagaaagttcggcgtgacgacgccg
cgcggcaagcctgccttctccgtcgacgaagctgtcaaggtcgccgaggaactgggcggc
aaggtgtgggtcgtgaaggcccagattcacgctggtggccgcggcaagggcggtggcgtg
aaggttgccaagtccctggatgaagtgcgccaatacgccacccagattctgggcatgcaa
ctggtgacccaccagaccggcccggaaggccagaaggtccgccgcctgctgattgaagaa
ggcgccgacatcaagaaggaatactacctggctgtcctgaccgaccgcgctacccagaag
gtcgccgtcatggcctcctccgaaggcggcatggacatcgaggaagtggcccacgccacc
cccgagaagatcctcaaggaattcgttgatcccctggtcggcatcaccgaccagcagacc
ctgaacctggcccagggcatcggcgttcccgccgactccgtggccaaggcccaggccgag
atcaagaagctgtaccagtgctacatggaaactgatgcttccctggcggaaatcaacccg
ctgatcctggaaggcaacggcaacatcaaggctctggacgccaagttcaacttcgactcc
aacgccctcttccgtcatcccgaaatcgtcgaataccgcgatctggatgaagaagacgcc
gacgaaatcgaagcctccaagttcgacctggcctacatctccctggacggcaacatcggc
tgtctggtgaacggtgccggtctggccatggccaccatggacaccatcaagctgttcggc
gccgagccggccaacttcctggacgtgggcggcggcgccaccaccgagaaggtcaccgaa
gccttcaagatcatgctcaagaaccccaaggtcaagggcatcctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtggtgaccgcggccaaggaagtgaac
ctgtccgtgccgctggtggtccgcatgaagggcaccaacgaggacctgggcaagcagatc
ctgaaggattccggtctgccgatcatttccgccgataccatggccgaagcggcccagaag
atcgtcgacgcggtcaagtaa

DBGET integrated database retrieval system