KEGG   Dechlorosoma suillum: Dsui_1505Help
Entry
Dsui_1505         CDS       T01657                                 

Definition
phage-related lysozyme (muraminidase)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dsu  Dechlorosoma suillum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1570345..1570809)
Genome map
AA seq 154 aa AA seqDB search
MIAVPQAAIDLAKRFEGFHRVPKNEPGRAHPYVCPAGYWTIGYGHLCDPKHPPITETDAE
RYLAADLMTALNATLRYCPVLATEPEKRLAAIVDFTFNLGAGRLQTSTLRRRINQRDWHS
AGQELRRWVYGGGKVLPGLVTRREAEATCLLRAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcggttccgcaggcggccatcgatctggccaagcgtttcgagggctttcaccgc
gtgccgaagaacgagcccggccgcgcgcatccctacgtctgcccagccggctactggacc
atcggctacggccacctctgcgatccgaagcacccaccgatcacggagaccgacgcagag
cgctacctggctgccgacctcatgacggcattgaacgcgacgctgcgctactgcccggtg
ctggccaccgagccagaaaagcgactcgcggccatcgtcgacttcaccttcaacctcggc
gcggggcgacttcaaacgtcgacgctgcggcggcggataaaccagcgggactggcatagt
gcgggccaagagctgcggcgctgggtgtatggcggtggcaaggtactgccggggcttgtc
acgcggcgagaggccgaggcgacttgcctgctccgcgccgcctga

DBGET integrated database retrieval system