KEGG   Dechlorosoma suillum: Dsui_1532Help
Entry
Dsui_1532         CDS       T01657                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dsu  Dechlorosoma suillum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dsui_1532
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dsui_1532
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dsui_1532
Lipid biosynthesis proteins [BR:dsu01004]
 Desaturase
  First
   Dsui_1532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1594684..1595898
Genome map
AA seq 404 aa AA seqDB search
MAFADILSSLLAFLRSGALDLPWWGVLLAALGMTHVTIVAVTVFLHRHQAHRALDLGALP
SHFFRFWLWLTTGMVTKEWTAIHRKHHAKCETAEDPHSPQVKGLWKVLSEGAELYRAEAA
NAETLARYGHGTPDDWLEGHVYARHPVLGVALMLVLDVLLFGAAGITVWAVQMAWIPFWA
AGVVNGLAHFWGYRNFACADASTNLWPLGLVIGGEELHNNHHAFATSARFSAKWYEVDIG
WGYIRLMSALGLARVKKVAPRPRLRSLRPQVDDHTLQALITHRYDLMTRYAKSLRQAYEA
ELRALRGRLDAVEFKRARDARRWLAGDLGRMPAELRQRFDALVQGSGPLQTLVAMREELS
AVWERTNASREQLLAHLQDWCRRAESSGIRQLEEMSLRLRRYAI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgccgatatcctgtcgtccctcctagcctttctccgttccggcgccctcgac
ctgccctggtggggcgtgctgctggccgccttgggcatgacccatgtgaccatcgtcgcc
gtcaccgtcttcctgcaccgccaccaggcccaccgggccctggatctgggggccctgcct
tcccattttttccgtttctggctgtggttgaccaccggcatggtgaccaaggaatggact
gccatccaccgcaagcaccacgccaagtgcgaaaccgccgaggatccccatagtccccag
gtgaagggcctgtggaaggtcctctccgaaggcgccgaactgtaccgggccgaggccgcc
aatgccgaaaccctggcccgctacggtcacggcacaccggacgactggctggagggccac
gtctatgcccggcatccggtgctcggcgtggccctcatgctggtgctggacgtgctgctc
ttcggcgccgccggcatcaccgtgtgggcggtgcagatggcctggattcccttctgggcg
gcgggggtggtcaatggcctggcccacttctggggctaccgcaacttcgcctgcgccgac
gcctccaccaatctctggcccctggggctggtcatcggcggcgaggaactgcacaacaac
caccatgccttcgccacttccgcccgcttctccgccaagtggtacgaggtggacatcggc
tggggctacatccgcctgatgagcgccctgggcctggcccgggtgaagaaggtggcgccc
cggccccggctgcgttccctgcggccccaggtggacgaccataccctgcaggctctcatc
acccaccgttacgatctcatgacccgttacgccaaatccctgcgccaggcctacgaggcc
gagttgcgggccctccgtgggcgtctcgatgcggtggagttcaagcgggcccgggacgcg
cggcgctggctggccggcgacctgggacggatgccggcggaactgcgtcagcgcttcgac
gccctggtccagggcagcggcccgttgcagaccctggtggccatgcgggaggagttgagc
gcggtgtgggagcgcaccaacgccagccgggagcagttgctggcccacctgcaggactgg
tgccgccgggccgaaagcagcggcatccgccagctggaagagatgtccctgcgtctgcgc
cgctacgccatttga

DBGET integrated database retrieval system