KEGG   Dechlorosoma suillum: Dsui_1601Help
Entry
Dsui_1601         CDS       T01657                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dsu  Dechlorosoma suillum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dsui_1601
Enzymes [BR:dsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dsui_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1681944..1682711)
Genome map
AA seq 255 aa AA seqDB search
MPLTGRTIVVTRPRAQADSLAQAIAAAGGTPLLYPLLEIEAADPAPLQAVAPRLADYAIV
FCVSPNAVEHALPTLLAAGPWPAGTRPAGVGTGTEKAWARFGLGQVIAPRERFDSEALLE
LPEFQAEAVAGKKVLILRGDGGRELLRETLEARGATVDVLTCYHRRPPSQGTAALEQAWT
AGRLDAIIISSSEALRHLWQLLDEDGRRRLAQTPLFVPHERIAQGAKDLGLQRVILTPPA
DQGLLAGLCAYNWAQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgaccggccgcaccatcgtcgtcacccggccccgggcccaggcggacagcctg
gcccaggccattgccgctgccggcggcactcccctgctctaccccctgctggaaatcgag
gccgccgacccggcgccgctgcaggccgtggccccccgtctggcggactacgccatcgtc
ttctgcgtcagtcccaatgcggtggaacacgccctgcccactctcctggcggccggcccc
tggccggcaggcacccgcccggccggcgtcggcaccggcacggaaaaggcctgggcccgc
ttcggcctgggccaggtcatcgcccccagggaacgtttcgactccgaggcattgctggaa
ctgccggaattccaggccgaggccgtggccggcaagaaggtgctgatcctgcgcggcgat
ggcggccgggagctgctgcgggaaaccctggaagcccggggcgccacggtggacgtgctc
acctgctaccaccgccgcccgccgagccagggcactgcagccctggaacaggcctggacc
gccggccgccttgatgccatcatcatctcctccagcgaagccctgcgccacctgtggcag
ttgctggacgaagacggccgccgccgcctggcccaaacgcccctgttcgtcccccacgag
cgcatcgcccagggggccaaggacctgggactgcaacgggtcatcctcacgccccctgcc
gaccagggcctattggccggcttatgcgcctataattgggctcaataa

DBGET integrated database retrieval system