KEGG   Dechlorosoma suillum: Dsui_1670Help
Entry
Dsui_1670         CDS       T01657                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
dsu  Dechlorosoma suillum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1755519..1756628)
Genome map
AA seq 369 aa AA seqDB search
MNVTPLSKTLLLTLLLAAGPALAAAPDIACRSNGSWDNACLRRLYQGAPGTWPKPQVDAG
VTWQEMAPVPAVAPAASPRQAARVALGRALFFDPHLSAKGQVSCASCHQPEKSFTDGKPL
AVGEDQLMGRRRTPPLFAAPFAAKLFWDGRVDSLEAQVLGPIANPVEMNHPIAAAVARVN
GLEEHRSLIQAAFAAPALDEAQLAWALADFVRSLRPPATAFDRFLAGRRNALSDKELQGL
HLFRTQARCMNCHNGPLLTDHGFHHIGLSYYGRRNQDLGRFEVTREKADLGAFRTPSLRG
VAQAGPWMHNGVFPDLKGLLRMYGNAMGNPTAKAVAAGDPYAPPLSPLIRKLELNEADVE
ALAAFLQTL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcacaccactttccaagaccctcctcctcaccctgctgctggcggccggccca
gccctggccgccgcccccgatatcgcctgccgcagcaatggcagctgggacaacgcctgc
ctgcgccggctctaccagggtgcccccggcacctggcccaagccccaggtggatgcgggc
gtgacctggcaggaaatggcgccggtgcccgccgtggcgcccgccgcaagcccccgccag
gccgcccgggtggccctgggccgggccctcttcttcgacccccacctctccgccaagggc
caggtttcctgcgcttcctgccaccagccggaaaaatccttcaccgacggcaagcccctg
gccgtgggcgaggaccagctcatgggccgccgccgcaccccgcccctcttcgccgccccc
ttcgccgccaagctgttctgggacggccgggtggacagcctggaagcccaggtgctcggc
cccatcgccaacccggtggagatgaaccaccccatcgccgccgccgtggccagggtcaac
ggcctggaggaacaccgcagcctgatccaggccgccttcgccgcccccgccctggatgag
gcccagctggcctgggccctggccgacttcgtgcgtagcctgcgcccgccggccacggcc
ttcgaccgtttcctggccgggcgcaggaacgccctttccgacaaggagttgcagggcctg
cacctgttccgcacccaggcccgctgcatgaactgccacaacggccccctgctcaccgac
cacggtttccaccacatcggcctctcctactacggccgccgcaaccaggacctgggccgc
ttcgaagtgacccgggagaaggccgacctaggtgccttccgcacccccagcctgcggggc
gtggcccaggccgggccgtggatgcacaacggcgtcttccccgacctgaagggtctgctg
cgcatgtacggcaacgccatgggcaaccccacggccaaggccgtggccgccggcgacccc
tacgccccgcccctgtcgcccctgatccgcaagctggaactgaacgaggccgacgtggag
gccctggccgccttcctgcagaccctttaa

DBGET integrated database retrieval system