KEGG   Dechlorosoma suillum: Dsui_1713Help
Entry
Dsui_1713         CDS       T01657                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dsu  Dechlorosoma suillum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dsui_1713
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dsui_1713
Enzymes [BR:dsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dsui_1713
Two-component system [BR:dsu02022]
 CheA family
  CheA-CheYBV
   Dsui_1713
Bacterial motility proteins [BR:dsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dsui_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1801915..1802940
Genome map
AA seq 341 aa AA seqDB search
MPIRVLVIDDSAVMRKLLTEFINSQPDLEVVGAAPDAPTAREMIKTVNPDVLTLDVAMPK
MDGLEFLERLMRLRPMPVVMVSSYTEAGSDTTLKALELGAVEFIGKPRVEPGHSLDDYAQ
ELAEKIRAAKGARLRKPPAAAQPVPSVPRGVTTNKIIFVGASTGGTEALKHFLLGMPADC
PPILVVQHMPETFTASFAKRLDSLCAPRVIESKGNEKVEAGTVYIAPGHSHLQVRKTASG
LVTELLQTPPVNRHRPAVDVLFHSAAQLVGRNALGVILTGMGKDGAQGLLAMHQAGARTY
GQDEASCVVYGMPREAAQIGAVDEVVSLDEMSRRVLAGLGR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcctatccgtgtactcgtaatcgacgattcggcggtgatgcgcaagctgctcaccgaa
ttcatcaattcccagcccgacctggaggtcgtgggagccgctcccgacgcgccgacggcc
cgggagatgatcaagaccgtcaatccggacgtgctgacgctggacgtggccatgccgaaa
atggacggcctggagttcctcgagcgcctgatgcgcctgcggcccatgccggtggtgatg
gtctcctcctataccgaggccggttccgataccaccctcaaggccctggaactgggcgcc
gtcgaattcatcggcaagccccgggtggagcccggccattccctggacgactacgcccag
gaactggcggagaagatccgggcggccaagggggcgcgcctgcgcaagccgccggccgca
gcccagcccgtaccctccgtgccccggggcgtgaccaccaacaagatcattttcgtcggc
gcctccaccggcggcaccgaggccctcaagcatttcctgctgggcatgccggccgattgc
ccacccatcctggtggtgcagcacatgcccgagaccttcaccgcctccttcgccaagcgc
ctcgacagcctgtgcgcgccccgggtcattgaatccaagggcaatgaaaaggtggaggcc
ggaaccgtctatatcgcccccggccattcccacctgcaggtacgcaagaccgcctctggt
ctggtgaccgaactgttgcagaccccgcccgtgaaccggcaccggccggcggtcgatgtg
ctgttccactctgccgcccagctggtggggcgcaacgccctcggggtgatcctcaccggc
atgggcaaggacggcgcccagggcctgctggccatgcatcaggccggagcccgcacctac
ggccaggacgaggccagctgcgtggtctacggcatgccccgggaagccgcccagatcggt
gcggtggacgaggtggtcagcctcgacgaaatgtcgcgccgggtgctagccggcctgggg
cgctag

DBGET integrated database retrieval system