KEGG   Dechlorosoma suillum: Dsui_1789Help
Entry
Dsui_1789         CDS       T01657                                 

Definition
diguanylate cyclase domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
dsu  Dechlorosoma suillum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1888326..1890104)
Genome map
AA seq 592 aa AA seqDB search
MAALSNPSEIAREVLRQLAVRRIPPTPDNYFTLYNEIAEHPPGDEPFPEKQCKSLAAALD
RSRPAQQRLARSFDEAIRDKSWERFQNTWKAFCTEASSEPPPWSDLIAELIRQWETHHAG
LTPGKKRDSLEHVLSSAGKDPDLLFTRLKGLLTSWNQNADAGGTPLADAPEMAAEDNGAD
AVAATTAPASADNALVGELRELFAFTLETAVATQLVESPQLVEEARTLASAVRRAQDTKA
LKKLLDKLKQFAFRLELLADDQRELRTGLLHLLQLLIENVSELVEDDQWLHGQIEMVRDI
VTSPLSLRTIDDAEQRIKEVIFKQSQLKHSLSEAQEALKHMLAGFVDHLADFADSTSDYH
DKVEACAQRIATANNIADLRAVIDEVMHETRIIQLNAQRSRDELRATQQRVRESEQRVAE
LQGELDKASTLVRHDQLTGALNRHGLEEAFAKETARTQRRRTSLCLAILDIDNFKKLNDS
LGHDAGDAALIHLITVIKNTMRPTDLVARFGGEEFVILLPDTGLEDSTHALQRLQRELTK
HYFMHDNQKLLITFSAGVTAYQPGEDQAAAIKRADTAMYEAKRTGKNRVVTA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctctccaatccctccgaaattgctcgtgaagtcctccgacaactggccgtc
cggcgcataccgccgactccggacaattacttcactctctacaacgaaattgccgaacac
ccgccgggggatgagccgttcccggaaaagcagtgcaaaagcttggcggccgcccttgac
cgcagccgaccggcccagcagcgccttgccaggtctttcgacgaggcgatccgggacaag
agctgggaacgcttccagaacacctggaaggcgttctgtaccgaagccagcagcgaaccg
ccgccctggagcgacctcattgccgaactgatccggcaatgggaaacccatcatgccggc
ctgacgcccggcaagaaacgggactccctggaacacgtgctatccagtgccggcaaggat
ccggacctgctcttcacccgcctgaaagggctcctcacttcctggaaccagaatgcggac
gccggcggcacacccctggccgacgcccccgagatggcagcggaggacaacggcgccgat
gctgtcgccgcgaccacagcaccggccagcgccgacaacgccctggtcggcgaactgcgg
gaactgtttgccttcaccctggaaacggccgtcgccacccagctggtggagtcgccccag
ttggtggaagaagcccgtaccctggccagcgccgtgcgccgggcccaggacacaaaggcc
ctgaaaaagctgctggacaagctcaagcagttcgccttccgcctcgaactgctggcggat
gaccagcgggagctgcgcaccggcctgctgcatctgctgcaactgctgatcgagaacgtc
agcgaactggtggaagacgaccagtggctgcatggtcagatcgaaatggtgcgggacatc
gtcaccagccccctctccctgcgcaccattgacgacgccgagcagcgcatcaaggaagtc
atcttcaagcagagccagctcaaacacagcctgagcgaagcccaggaggccctgaagcac
atgctggcgggcttcgtggaccatctggccgatttcgccgactccacctccgactaccat
gacaaggtggaggcctgtgcccagcgcattgccacggccaacaacattgccgacctgcgg
gccgtcattgacgaagtgatgcacgaaacccgcatcatccagctcaatgcccagcgctcc
cgcgacgaactgcgggccacccagcagcgggtgcgggaatcggaacagcgggtggccgaa
ctgcagggcgagctggacaaggccagcaccctggtgcgccacgaccagctcaccggtgcc
ctcaaccgccacggcctggaggaagccttcgccaaggaaacggcccgcacccagcggcgg
cgcacctccctctgcctggccatcctggacatcgacaacttcaagaagctcaacgacagc
ctgggccacgatgccggcgacgccgccctgatccacctcatcacggtcatcaagaacacc
atgcgccccaccgacctggtagcccgcttcggtggcgaggagtttgtcatcctgctgccg
gacaccggcctggaagactcgacccacgccctgcaacggctgcagcgggagctgaccaag
cactacttcatgcacgacaaccagaagctgctgatcaccttcagcgccggcgtcactgcc
taccagcccggcgaagaccaggccgcggccatcaagcgggcagatacggccatgtacgaa
gccaagcgcacgggcaagaaccgggtggtgacggcctaa

DBGET integrated database retrieval system