KEGG   Dechlorosoma suillum: Dsui_1789Help
Entry
Dsui_1789         CDS       T01657                                 

Definition
(GenBank) diguanylate cyclase (GGDEF) domain-containing protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
dsu  Dechlorosoma suillum
Brite
Enzymes [BR:dsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Dsui_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1888326..1890104)
Genome map
AA seq 592 aa AA seqDB search
MAALSNPSEIAREVLRQLAVRRIPPTPDNYFTLYNEIAEHPPGDEPFPEKQCKSLAAALD
RSRPAQQRLARSFDEAIRDKSWERFQNTWKAFCTEASSEPPPWSDLIAELIRQWETHHAG
LTPGKKRDSLEHVLSSAGKDPDLLFTRLKGLLTSWNQNADAGGTPLADAPEMAAEDNGAD
AVAATTAPASADNALVGELRELFAFTLETAVATQLVESPQLVEEARTLASAVRRAQDTKA
LKKLLDKLKQFAFRLELLADDQRELRTGLLHLLQLLIENVSELVEDDQWLHGQIEMVRDI
VTSPLSLRTIDDAEQRIKEVIFKQSQLKHSLSEAQEALKHMLAGFVDHLADFADSTSDYH
DKVEACAQRIATANNIADLRAVIDEVMHETRIIQLNAQRSRDELRATQQRVRESEQRVAE
LQGELDKASTLVRHDQLTGALNRHGLEEAFAKETARTQRRRTSLCLAILDIDNFKKLNDS
LGHDAGDAALIHLITVIKNTMRPTDLVARFGGEEFVILLPDTGLEDSTHALQRLQRELTK
HYFMHDNQKLLITFSAGVTAYQPGEDQAAAIKRADTAMYEAKRTGKNRVVTA
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctctccaatccctccgaaattgctcgtgaagtcctccgacaactggccgtc
cggcgcataccgccgactccggacaattacttcactctctacaacgaaattgccgaacac
ccgccgggggatgagccgttcccggaaaagcagtgcaaaagcttggcggccgcccttgac
cgcagccgaccggcccagcagcgccttgccaggtctttcgacgaggcgatccgggacaag
agctgggaacgcttccagaacacctggaaggcgttctgtaccgaagccagcagcgaaccg
ccgccctggagcgacctcattgccgaactgatccggcaatgggaaacccatcatgccggc
ctgacgcccggcaagaaacgggactccctggaacacgtgctatccagtgccggcaaggat
ccggacctgctcttcacccgcctgaaagggctcctcacttcctggaaccagaatgcggac
gccggcggcacacccctggccgacgcccccgagatggcagcggaggacaacggcgccgat
gctgtcgccgcgaccacagcaccggccagcgccgacaacgccctggtcggcgaactgcgg
gaactgtttgccttcaccctggaaacggccgtcgccacccagctggtggagtcgccccag
ttggtggaagaagcccgtaccctggccagcgccgtgcgccgggcccaggacacaaaggcc
ctgaaaaagctgctggacaagctcaagcagttcgccttccgcctcgaactgctggcggat
gaccagcgggagctgcgcaccggcctgctgcatctgctgcaactgctgatcgagaacgtc
agcgaactggtggaagacgaccagtggctgcatggtcagatcgaaatggtgcgggacatc
gtcaccagccccctctccctgcgcaccattgacgacgccgagcagcgcatcaaggaagtc
atcttcaagcagagccagctcaaacacagcctgagcgaagcccaggaggccctgaagcac
atgctggcgggcttcgtggaccatctggccgatttcgccgactccacctccgactaccat
gacaaggtggaggcctgtgcccagcgcattgccacggccaacaacattgccgacctgcgg
gccgtcattgacgaagtgatgcacgaaacccgcatcatccagctcaatgcccagcgctcc
cgcgacgaactgcgggccacccagcagcgggtgcgggaatcggaacagcgggtggccgaa
ctgcagggcgagctggacaaggccagcaccctggtgcgccacgaccagctcaccggtgcc
ctcaaccgccacggcctggaggaagccttcgccaaggaaacggcccgcacccagcggcgg
cgcacctccctctgcctggccatcctggacatcgacaacttcaagaagctcaacgacagc
ctgggccacgatgccggcgacgccgccctgatccacctcatcacggtcatcaagaacacc
atgcgccccaccgacctggtagcccgcttcggtggcgaggagtttgtcatcctgctgccg
gacaccggcctggaagactcgacccacgccctgcaacggctgcagcgggagctgaccaag
cactacttcatgcacgacaaccagaagctgctgatcaccttcagcgccggcgtcactgcc
taccagcccggcgaagaccaggccgcggccatcaagcgggcagatacggccatgtacgaa
gccaagcgcacgggcaagaaccgggtggtgacggcctaa

DBGET integrated database retrieval system