KEGG   Dechlorosoma suillum: Dsui_1811Help
Entry
Dsui_1811         CDS       T01657                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dsu  Dechlorosoma suillum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dsui_1811
DNA repair and recombination proteins [BR:dsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dsui_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1908905..1909507
Genome map
AA seq 200 aa AA seqDB search
MSTPSSLEELIEALRCLPGIGPKSAQRMAYHLLQRDRKGARRLADGMSHALEAIRHCSRC
NTFTESEICERCASTKRDASLLCVVETPVDMNMMEQTQAYNGLYYVIMGRLSPLDGVGPR
ELQLDRLLARACDGEVQEVILATNYTNEGEATAHYVSELLRSRGIKVTRIARGVPVGGEL
EYVDAGTLAQAMRERKNVEA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccatccagcctcgaagaactgatcgaggccctccgttgtttgccggggatc
gggccgaaatcggcccagcgcatggcctaccatctgctgcagcgggaccgcaagggtgcc
cgccgcctggcagacggcatgtcccatgcgctggaggccattcgccattgcagccgctgc
aacaccttcaccgagtccgagatctgcgagcgctgcgcctccaccaagcgggatgccagc
ctgctgtgcgtcgtcgaaacgccggtggacatgaacatgatggagcagacccaggcctac
aacgggctctactacgtcatcatggggcgcttgtcgccgctggacggtgtcggtccccgg
gagctgcagctggaccgtctgctggcccgggcctgcgatggcgaggtccaggaggtcatc
ctggccactaattacaccaacgaaggcgaagcgaccgctcactacgtcagcgaactgctg
cgcagcaggggcatcaaggtgacccggatcgcccggggggtgccggtgggtggggagctg
gagtacgtggatgccggcaccctggctcaggccatgcgggagcggaaaaacgtggaagcc
tag

DBGET integrated database retrieval system