KEGG   Dechlorosoma suillum: Dsui_1951Help
Entry
Dsui_1951         CDS       T01657                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dsu  Dechlorosoma suillum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Dsui_1951
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dsui_1951
Enzymes [BR:dsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Dsui_1951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2063377..2063925
Genome map
AA seq 182 aa AA seqDB search
MKAIRTAIPEVIVLEPRIFGDARGFFMESYNRRTFAELTGCDPDFVQDNHSRSARGVLRG
LHYQIRQPQGKLVRVVSGAVFDVAVDIRRSSPTCGQWVGEVLSAENQRQMWVPAGFAHGF
LVLSETAEFLYKTTDYYAPEFERCIAWNDPGLAVDWPLDGLEPRLSAKDAQGASMADAEL
FD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcaatcaggacggccattcccgaggtgatagtcctggaacccaggattttcggc
gatgcccggggcttcttcatggaaagctataaccggcgcaccttcgccgagcttaccggc
tgtgatccggatttcgtccaggacaaccattcccgctccgcccggggcgtgctgcgcggc
ctgcattaccagatccgccagccccagggaaaactggtgcgggtggtgagcggtgccgtg
ttcgacgtggcggtggacatccgccgcagttcccccacctgcggccagtgggtgggcgaa
gtgctgtcggcggaaaaccagcgccagatgtgggtgccggccggctttgcccatggtttc
ctggtgctcagcgagaccgccgaattcctctacaagaccaccgattactacgcgccagaa
ttcgagcgctgcattgcctggaacgaccccgggctggccgtggactggcccctggacggg
ctggagccccgcctgtcggccaaggatgcccagggcgccagcatggcggatgccgaactt
tttgattga

DBGET integrated database retrieval system