KEGG   Dechlorosoma suillum: Dsui_1969Help
Entry
Dsui_1969         CDS       T01657                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dsu  Dechlorosoma suillum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2077202..2077876
Genome map
AA seq 224 aa AA seqDB search
MATGVSGIGMTSLRTRMRMVERLRDKGIVDETVLAAMAAVPRHIFVEEAMAHRAYEDTAL
PLGHSQTISQPYIVARMIELLRAGREQSLPGGLGKTLEIGAGCGYQAAVLAQLAPDVYAV
ERIEPLIERAKQNLRQMQQFNVRLKYADGQLGLPEAAPYHTIIVAAAANRVPPALLQQLA
VGGRMVLPVGAGEQALHLIERTPQGFLETKLDAVRFVPLLSGVE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgggcgtttccggtatcggcatgacctccctgcgcacccgcatgcgcatggtg
gagcgtctgcgggacaagggcatcgtggacgagacggtgcttgccgccatggctgccgtg
ccccgccacatcttcgtcgaagaggccatggcccaccgggcctatgaggacacggccctg
cctctggggcattcccagaccatttcccagccctatatcgtggcccgcatgatcgaactg
ttgcgggccgggcgtgaacagagcctgcccggcggtctcggcaagactctggagatcggc
gccggttgcggctaccaggcagcggtgctggcccagctggcgccagacgtctatgccgtg
gaacggatcgagcccctgatcgaacgggccaagcagaacctgcggcagatgcagcagttc
aacgtgcgcctcaagtatgccgacggccaactggggctgccggaagcggccccctatcac
accatcatcgtcgccgccgcggccaaccgggtgccgcccgcgcttttgcagcagctggcg
gttggtggcagaatggtcctgcccgtgggggccggcgagcaagctctgcacctgatcgaa
cgcacgccccaggggttccttgagaccaagcttgacgcggtgcgtttcgtgccgctgctg
tcaggagtcgaatga

DBGET integrated database retrieval system