KEGG   Dechlorosoma suillum: Dsui_2065Help
Entry
Dsui_2065         CDS       T01657                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dsu  Dechlorosoma suillum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dsui_2065
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Dsui_2065
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Dsui_2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2183513..2184088)
Genome map
AA seq 191 aa AA seqDB search
MARLFTPDGKYEADPATVNALARSLGLTLRHLPLPRDPQTAALLARPELDPAQQAQLLQY
LDASLGQAVQAPVGAGRDLVAFHADLPELPRLRQQFAQVHTHTDHEVRYILAGTGYFGVV
RADGSQVLLEAGPGDYLEVPAGTEHWFALGPDPGLKALRLFSREKQWVADYTGRQADPAL
LGLLQAGTDSH
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcctgttcacccccgatggcaagtacgaagccgacccggccaccgtcaacgcc
ctcgcccgcagcctgggcctgaccctgcgccacctgcccctgccccgggacccgcaaacc
gccgccctgctggcccggcccgaactggacccggcgcaacaggcccagctgctgcaatac
ctcgatgccagcctgggccaggccgtgcaggcccccgtcggcgccggccgggacctggtg
gccttccacgccgacctgcccgagctgccccgcctgcgccagcagttcgcccaggtccat
acccatacggaccacgaggtgcgctacatcctggccggcaccggctacttcggcgtggtc
cgggcggatggcagccaggtgctgctggaagcgggccccggcgattacctggaagtcccc
gccggcaccgaacactggttcgccctcggccctgaccctgggctcaaggccctgcgcctc
ttttcccgggagaagcagtgggtcgccgactacaccgggcgccaggccgaccccgccctg
ctgggcctgctgcaggccggcaccgacagccactga

DBGET integrated database retrieval system