KEGG   Dechlorosoma suillum: Dsui_2065Help
Entry
Dsui_2065         CDS       T01657                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dsu  Dechlorosoma suillum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dsu00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2183513..2184088)
Genome map
AA seq 191 aa AA seqDB search
MARLFTPDGKYEADPATVNALARSLGLTLRHLPLPRDPQTAALLARPELDPAQQAQLLQY
LDASLGQAVQAPVGAGRDLVAFHADLPELPRLRQQFAQVHTHTDHEVRYILAGTGYFGVV
RADGSQVLLEAGPGDYLEVPAGTEHWFALGPDPGLKALRLFSREKQWVADYTGRQADPAL
LGLLQAGTDSH
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcctgttcacccccgatggcaagtacgaagccgacccggccaccgtcaacgcc
ctcgcccgcagcctgggcctgaccctgcgccacctgcccctgccccgggacccgcaaacc
gccgccctgctggcccggcccgaactggacccggcgcaacaggcccagctgctgcaatac
ctcgatgccagcctgggccaggccgtgcaggcccccgtcggcgccggccgggacctggtg
gccttccacgccgacctgcccgagctgccccgcctgcgccagcagttcgcccaggtccat
acccatacggaccacgaggtgcgctacatcctggccggcaccggctacttcggcgtggtc
cgggcggatggcagccaggtgctgctggaagcgggccccggcgattacctggaagtcccc
gccggcaccgaacactggttcgccctcggccctgaccctgggctcaaggccctgcgcctc
ttttcccgggagaagcagtgggtcgccgactacaccgggcgccaggccgaccccgccctg
ctgggcctgctgcaggccggcaccgacagccactga

DBGET integrated database retrieval system