KEGG   Dechlorosoma suillum: Dsui_2183Help
Entry
Dsui_2183         CDS       T01657                                 

Definition
aldose 1-epimerase-like enzyme
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dsu  Dechlorosoma suillum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dsu00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2318747..2319619)
Genome map
AA seq 290 aa AA seqDB search
MSASQKLGNTTFHGLDAVRLTLPDGSTAVISAFGAQALSWVPAGGGERLYLSPQADFGGS
VPIRGGVPVIFPQFAERGPLPKHGFARTATWTLEEWREQPEAEEGGFACAVYSLTADDAS
RALWPHDFRAELTVALTRDRLDIELEVENPGSEPLEFTGGLHTYLRVKEVENVTLTGLHG
SRRQLPGSQETKVETGPELMVDDEVDQVYLDVPRPLLLKDGRQALAIASEGFPDVVVWNP
WEHLCAGLKDMPANGFRHMLCVEAVAVGKPVVVAPGASWWGRQTLVTLDA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcatcccagaaactcggcaacaccaccttccacggcctcgacgccgtccgcctc
accctgcccgacggcagcaccgccgtcatcagcgccttcggcgcccaggccctgtcctgg
gtccccgccggcggcggcgagcgcctctatctcagcccccaggccgacttcggcggcagc
gtccccatccgtggcggcgtgccggtgatctttccccagttcgccgagcgcggccccctg
cccaagcacggtttcgcccgcaccgccacctggaccctggaagagtggcgcgaacagccg
gaagcggaagaaggcggcttcgcctgcgccgtctacagcctcacggccgacgacgccagc
cgggccctgtggccccatgacttccgcgccgagctgaccgtggccctgacccgcgaccgc
ctggacatcgaactggaagtggagaatccgggcagcgaacccctggaattcaccggcggc
ctgcacacctatctgcgcgtcaaggaagtggagaacgtcaccctcaccggcctccacggc
agccgccgccagcttcccggcagccaggagaccaaggtcgagaccggcccggaactgatg
gtggatgacgaggtggatcaggtctatctggacgtgccccgccccctgctgctgaaggac
ggacgccaggccctggccatcgccagcgagggctttcccgacgtggtggtgtggaacccc
tgggaacacctctgcgccggcctcaaggacatgccggccaacggtttccgccacatgctg
tgcgtcgaggccgtggccgtgggcaagccggtggtggtggcccccggcgcctcctggtgg
ggccgccagaccctggtgaccctggacgcctga

DBGET integrated database retrieval system