KEGG   Dechlorosoma suillum: Dsui_2218Help
Entry
Dsui_2218         CDS       T01657                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dsu  Dechlorosoma suillum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsui_2218
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dsui_2218
  Amino acid metabolism
   00310 Lysine degradation
    Dsui_2218
Enzymes [BR:dsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dsui_2218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2358076..2359284
Genome map
AA seq 402 aa AA seqDB search
MIIDVKVPQLSESVAEATLVSWHKKAGEAVSRDENLIDIETDKVVLELPAPDAGVIVKII
KGDGDTVVSGEVIAQIDTEAKAAAGAAPAAAAAPAAAAPAPVAAAAAPAAAAGTASPAAR
KILDEKGIAAADVSGTGRGGRVTKEDAVGAQAKAAAPAVAAPAVSIPLGDRPEQRVPMTR
LRARIAERLLQSKNENAILTTFNEVNMAPVMALRKQYGDKFEKEHGVRLGFMGFFVKAAV
AALKKYPILNASVDGNDIVYHGYIDIGIAVGSPRGLVVPILRDADQMSIADIEKKIAEYG
QKAKDGKISIEELTGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKDRAVVENGQVV
VRPINYLAMSYDHRIIDGREAVLGLVTMKEALEDPARLLLGV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgacgtcaaagtcccgcaactgtccgaatccgttgccgaagccaccctggtg
tcctggcacaagaaggcaggcgaagctgtcagccgcgatgagaacctcatcgatatcgaa
accgacaaggtggtcctggaactgcccgctcccgatgccggcgtgatcgtcaagatcatc
aagggcgacggcgacaccgtggtttccggcgaagtcatcgcccagatcgacaccgaggcc
aaggccgccgccggcgccgctccggctgccgccgctgctcccgccgctgccgcgccggcc
ccggtggctgctgccgctgctccggctgctgctgccggcaccgccagccccgccgcccgc
aagatcctggacgagaagggcatcgctgccgccgacgtctccggcaccggccgtggtggc
cgtgtcaccaaggaagacgccgtgggcgcccaggccaaggccgccgcgcccgccgtggct
gcccctgccgtgtccatccccctgggtgaccgtcccgagcagcgcgttcccatgacccgc
ctgcgcgcccgcattgccgagcgcctgctgcagtccaagaacgaaaacgccatcctcacc
accttcaacgaagtgaacatggccccggtcatggccctgcgcaagcagtacggcgacaag
ttcgagaaggaacatggcgtgcgtctgggcttcatgggcttcttcgtcaaggcagccgtg
gctgccctgaagaagtacccgatcctgaacgcctccgtcgatggcaacgacatcgtctat
cacggctacatcgacatcggtatcgccgtgggctccccccgcgggctggtggtgcccatc
ctgcgtgatgccgaccagatgtccatcgccgacatcgagaagaagattgccgaatacggc
cagaaggccaaggacggcaagatctccatcgaagaactgaccggtggcaccttctccatc
tccaacggcggcgtgttcggctccatgctctccacccccatcatcaacccgccccagtcc
gcgatcctcggcatccatgccaccaaggaccgcgccgtggtcgagaacggtcaagtggtg
gtgcgccccatcaactacctggccatgtcctacgaccaccgtatcatcgacggccgcgaa
gccgtgctgggtctggtgaccatgaaggaagccctggaagatcccgcccgcctgctgctc
ggcgtttaa

DBGET integrated database retrieval system