KEGG   Dechlorosoma suillum: Dsui_2228Help
Entry
Dsui_2228         CDS       T01657                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dsu  Dechlorosoma suillum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dsui_2228
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsui_2228
  Lipid metabolism
   00071 Fatty acid degradation
    Dsui_2228
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dsui_2228
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dsui_2228
   00626 Naphthalene degradation
    Dsui_2228
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dsui_2228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2368812..2369834)
Genome map
AA seq 340 aa AA seqDB search
MAQMMKAAVVHEFGKPLVIEEVPVPEVPPGQVLVKVVASGVCHTDLHAADGDWPVKPSLP
FIPGHEGVGYVAAVGAGVTHVKEGDRVGVPWLHTACGHCEHCITGWETLCDSQQMTGYTV
NGGYAEYVLADPGYVGKLPDTLEFAPAAPVLCAGVTVYKGLKVLECKPGDWVAISGIGGL
GHMAVQYAKAMGFHVIAVDVADEKLALAKTLGADVTLNAARVDPVAEIQKQIKGAHGILV
TAVSRSAFGQALGMLHKRGTMSLVGLPPGDFGLPIFDVVLNAKTVRGSIVGTRKDLEEAL
AFAGEGKVKTHYSTDRIENINDIFGRMKAGHIDGRIVLNI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatgatgaaagccgccgtcgtccacgaattcggcaagcccctggtgatcgag
gaagtgcccgtgcccgaggtgccgcccgggcaggtgctggtcaaggtggtggcctccggg
gtctgccacaccgacctccacgccgccgacggcgactggccggtaaagccttccctgccc
ttcatccccggccatgagggggtcggctacgtggccgccgtcggcgccggcgtcacccac
gtcaaggaaggggaccgggtcggcgtcccctggctgcacactgcctgcggccattgcgaa
cactgcataaccggctgggaaaccctctgcgattcccagcagatgaccggctacacggtg
aacggcggctatgccgaatacgtgctggccgatccgggctatgtcggcaagctgcccgac
accctggaattcgcccccgccgccccggtgctgtgcgccggcgtcacggtgtacaagggg
ctcaaggtgctcgaatgcaagcccggcgattgggtcgccatctccggcatcggcggcctc
ggccacatggcggtgcagtacgccaaggccatgggcttccacgtcatcgccgtcgatgtg
gcggacgaaaagctggccctggccaagaccctgggcgccgacgtcaccctcaacgcggcc
cgggtggatccggtggcggagattcaaaagcagatcaagggtgcccacggcatcctggtc
accgccgtctcccgcagcgccttcggccaggccctgggcatgctgcacaagcgcggcacc
atgtccctggtgggcctgccccccggcgacttcggcctgcccatcttcgacgtggtgctc
aacgccaagaccgtgcgcggctccatcgtcggcacccgcaaggacctggaagaagccctg
gcctttgccggcgagggcaaggtgaagacccactacagcaccgaccggatcgagaacatc
aacgacatcttcggccgcatgaaggccggccacatcgacggccgcatcgtgctcaacatc
tag

DBGET integrated database retrieval system