KEGG   Dechlorosoma suillum: Dsui_2308Help
Entry
Dsui_2308         CDS       T01657                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dsu  Dechlorosoma suillum
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dsu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2464231..2464854
Genome map
AA seq 207 aa AA seqDB search
MREKILVVLKLLPWLMLLAAPEVMARTILVFGDSLSAGYGIRQEAAWPALLQNRLQERRF
DYSVVNASISGETTAGGRSRLEAALSKHQPSVLVLALGANDGLRGLPLAVMRDNLAAMIK
AARRQQIKVLLVGMRLPPNFGAYADDFHRSFAELARQEKLAYVDFLLDGMADKPQLFQAD
NLHPLAEAQPRLLDNVWTGLAPLLSGR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaaaaaatcctcgtcgttttgaagttgctgccctggctgatgctgctggcggcg
cctgaagtcatggccaggaccatcctggtcttcggcgattccctttccgccggctacggc
atccgccaggaggcggcctggccggccctgctgcagaaccggctgcaggaaaggcgtttc
gattatagcgtcgtcaatgccagcatctccggggaaaccactgccggtggccgttcccgt
ctggaggccgccttgagcaagcaccagccttcggtgctggtgctggccctgggggccaac
gacggcctgcggggcctgcccctggcggtgatgcgggacaacctggcggccatgatcaag
gcggcccgccggcaacagatcaaggtgctgctggtgggcatgcgcctgccgcccaatttc
ggcgcctatgccgacgacttccaccgcagcttcgccgaactggcccggcaggagaagctg
gcctacgtggatttcctgctggacggcatggcggacaaaccccagctgttccaggcggac
aacctgcatcccctggccgaggcccagccgcgcctgctcgacaatgtgtggacgggcctg
gcgcccctgctcagcgggcgctga

DBGET integrated database retrieval system