KEGG   Dechlorosoma suillum: Dsui_2312Help
Entry
Dsui_2312         CDS       T01657                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dsu  Dechlorosoma suillum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Dsui_2312
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Dsui_2312
Enzymes [BR:dsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Dsui_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2467804..2468586
Genome map
AA seq 260 aa AA seqDB search
MLSGKIALVTGSTSGIGLAVARALARNGAAVMLNGSRPAAEAEGLRAAMAAEFGVKVAYT
SADLADAASVRALAAAAEKQLGVVDILVNNAGIQHVAAVDEFPEEKWDQLIAINLSSVFH
ATKAVLPGMKARNWGRIVNIASAHGLVASPFKAPYTASKHAVVGFSKAVALEVAETGITC
NAVCPGYVRTPLVEKQVAAQAKVHNLPEDQVIRDVILAAQPNKRFLEADDLAEFVLFLCS
PAGAGMTGAALPMDGAWTAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctcagcggaaaaatcgctctcgtcaccggttccacctccggcatcggcctggccgtg
gcccgggccctggcccgtaacggcgccgcggtgatgctcaacggttcccgtccggcggcc
gaggcggaaggtctgcgggcggccatggccgccgagttcggtgtcaaggtggcctacacc
tcggccgacctggccgatgcggcctcggtgcgggccctggcggccgccgccgagaagcag
ctgggagtcgtggacatcctggtgaacaacgccggcatccagcacgtggcggcggtggat
gaattccccgaagagaagtgggaccagctcatcgccatcaacctgtcctccgtcttccat
gccaccaaggccgtgctgccgggcatgaaggcgcgtaactggggccgcatcgtcaatatc
gcctcggcccacggcctggtggcctcgcccttcaaggcgccctacaccgccagcaagcac
gcggtggtgggcttttccaaggcggtggccctggaggtggcggagaccggcatcacctgc
aacgcggtgtgccccggctatgtgcgcacgcccctggtggaaaagcaggtggcggcccag
gccaaggtgcacaacctgccggaggatcaggtgatccgcgacgtgatcctggcggcccag
cccaacaagcgcttccttgaggccgacgacctggccgagttcgtgctgttcctctgttcc
cccgccggcgccggcatgaccggcgccgccctgcccatggacggggcctggaccgcccgc
tga

DBGET integrated database retrieval system