KEGG   Dechlorosoma suillum: Dsui_2465Help
Entry
Dsui_2465         CDS       T01657                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dsu  Dechlorosoma suillum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dsui_2465
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Dsui_2465
Enzymes [BR:dsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dsui_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2621722..2622747
Genome map
AA seq 341 aa AA seqDB search
MNAPRQLPPGPVMIDIQGLALTDLDRERLTHPLVGGLILFSRNYESPEQLSALCAEVKAL
RSPQLLIAIDHEGGRVQRCRPGFTAIPAMGKLGALWDAAPGEAIAAAQDLGYVLAAELRA
RGVDFSFTPVLDLDYGRSTVIGSRSFHRQPEAVVQLAGALIQGLQLAGMGCCGKHFPGHG
WVQADSHVAIPVDERDWDKLLADMEPFRRLALDAVMPAHVIYPVVDQKSAGFSNYWINYL
RNNLKFDGVVFSDDLSMEGASVAGDVVARAQAAWSAGCDMLLVCNAPEAVGQLLERWQPS
LDPVRAARVQRLLPQKPAPDWADLQADPVYQRGVAAAGRLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctccccgacaactgcccccgggcccggtgatgatcgacatccagggcctggcc
ctgaccgatctggaccgggaacgcctgacccaccccctggtgggcggcctcatcctgttc
agccgcaattacgaaagcccggagcagctcagtgccctctgcgccgaggtcaaggccctg
cgcagtccccagttgctgattgccatcgaccacgaaggcggccgggtgcagcgctgtcgg
ccaggattcacggccattcccgccatgggcaagctgggcgccttgtgggatgcggcgcct
ggcgaggccatcgctgcggcccaggacctgggctatgtgctggccgccgagctgcgggcc
cggggcgtggatttctccttcactccggtgctggacctggactacggccgcagcacggtg
atcggcagccgttccttccaccgccagccggaagccgtggtgcaactggccggcgccctg
atccagggtctccaactggccggcatgggttgctgcggcaagcacttccccggccacggc
tgggtccaggccgactcccacgtggccattccggtggatgagcgggactgggacaagctc
ctggccgacatggaacccttccgtcgcctggccctggatgcggtcatgccggcccacgtg
atttacccggtagttgatcaaaaatccgcaggtttttcaaattactggattaattatctg
agaaacaacttgaagtttgacggcgtcgtttttagcgacgacctgtccatggaaggggcc
tccgtcgccggtgatgtggtggcccgggcccaggccgcctggagcgccggctgcgacatg
ctgctggtgtgcaatgcgccggaagcggtgggccagttgctggagcgctggcagccgtcc
ctggacccggtccgggccgcccgggtgcagcgcctgctgcctcaaaagcctgctccggat
tgggccgacctccaggccgatccggtctaccagcgcggcgtagccgccgccgggcgcctc
gcctga

DBGET integrated database retrieval system