KEGG   Dechlorosoma suillum: Dsui_2923Help
Entry
Dsui_2923         CDS       T01657                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dsu  Dechlorosoma suillum
Brite
Enzymes [BR:dsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dsui_2923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3125669..3126511
Genome map
AA seq 280 aa AA seqDB search
MPHPLPPGDDTAVLLLHGLYSNPNEMSPLGKELEKAGYRVAIPHLQGYTVCAEDVLDRRF
ARSPWEDWYAQVETVFDELRQQHRRVVVGGLCIGADLALHLAAQRGLQVAAVLALATTLY
YDGWGIPWYSFLLPLGYYTPLRHIYTYRERAPFGLKNPRVRARVERDMREREVSAAGASE
LPLNGIYQAQRLIGSIKKELPQVVSPTLVIHSREDDVASLRSPEQVYRRISAERRRKVVL
DDSYHIITLDNERRRVSGEALDFLAQVLGAPAAVRLPRAA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
ttgccccacccgcttccccccggcgacgacaccgccgtcctgctgctgcacggcctctac
agcaaccccaacgaaatgtcccccctcggcaaggagctggaaaaagccggctaccgcgtc
gccattccccatttgcagggctatacggtgtgcgccgaagacgtgctggaccgccgcttc
gcccgcagcccctgggaggactggtacgcccaggtggaaacggtcttcgacgaactgcgg
cagcagcatcgccgcgtcgtcgttggcggcctgtgcatcggcgccgacctggccctgcac
ctggcggcccagcggggcctgcaggtggcggcggtgctggccctggccaccaccctctac
tacgacggctggggcatcccctggtacagcttcctcctgcccctgggctactacacgccc
ctgcgccacatctacacctatcgggaacgggcccccttcggcctgaagaatccccgggta
cgggcccgggtggaacgggacatgcgggaaagggaagtctccgccgccggcgcctcggag
ctgcccctcaacggcatctaccaggcccagcgcctgatcggcagcatcaagaaggaatta
ccccaggtggtcagccccaccctggtgatccactcccgggaagacgacgtggccagcctg
cgcagcccggagcaggtataccgccgcatcagcgccgagcgccggcgcaaggtggtgctg
gacgacagctaccacatcatcaccctggacaacgagcggcgccgggtcagcggcgaggca
ctggattttctcgcccaggtgctgggcgcgccggctgcggtcaggctgccccgggccgcc
tga

DBGET integrated database retrieval system