KEGG   Dechlorosoma suillum: Dsui_3052Help
Entry
Dsui_3052         CDS       T01657                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00010  Glycolysis / Gluconeogenesis
dsu00051  Fructose and mannose metabolism
dsu00562  Inositol phosphate metabolism
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
dsu01130  Biosynthesis of antibiotics
dsu01200  Carbon metabolism
dsu01230  Biosynthesis of amino acids
Module
dsu_M00002  Glycolysis, core module involving three-carbon compounds
dsu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsui_3052
   00051 Fructose and mannose metabolism
    Dsui_3052
   00562 Inositol phosphate metabolism
    Dsui_3052
Enzymes [BR:dsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dsui_3052
Exosome [BR:dsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dsui_3052
  Exosomal proteins of bladder cancer cells
   Dsui_3052
  Exosomal proteins of melanoma cells
   Dsui_3052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEV27386
UniProt: G8QHJ3
Position
complement(3266760..3267485)
Genome map
AA seq 241 aa AA seqDB search
MHGGLAANRSLLQGVVAGVKGLAAAVECAVCVPYPYLAQAQQELAKTEVSWGAQNLSEQV
SGAFTGEVSAAMLKDFGCRYVIVGHSERRALYGEDDGLVAKKFKQALAGGLVPILCVGET
LAQRESGQAAEVVAAQLDAVLDAAGVEVFAGAVVAYEPVWAIGTGLTASPAQAQAVHEGI
RARLAARNAEVAAGVRVLYGGSVKAGNAAELFAMPDIDGALVGGASLVAEEFVAICRAAA
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcggcttggcagccaaccgttccctgctccagggtgtggttgccggggtgaag
gggcttgccgctgcggtcgagtgtgccgtttgtgttccctatccgtacctggctcaggcc
cagcaggagctggctaagactgaggtgagttggggggcgcaaaacctgagcgagcaggtc
tcgggggcatttaccggtgaggtaagtgcggcaatgctcaaggattttggctgtcgctat
gtcatcgtcggccactcggagcgccgggcgctctatggcgaggatgacgggctggtggca
aagaagttcaagcaggctctggcgggcgggttggtgccgattctgtgtgtcggtgaaacc
ctggctcagcgggagtccggtcaggcggctgaggtggttgctgctcagctggatgcggtc
ctggatgccgcgggtgttgaggttttcgccggagcggtggttgcctatgagcccgtgtgg
gccatcggtaccggcctcacggcctctcccgcccaggcccaggcggtgcatgaagggatt
cgtgcccgactggcggcaagaaatgcagaagtggctgccggagtgcgtgtgctctacggt
ggcagcgtcaaggcggggaatgcggcggagttgtttgccatgcccgatatcgacggggct
ttggtcggcggcgcatccctggtggcggaagaattcgtggccatttgtcgtgcggctgcc
ttttga

DBGET integrated database retrieval system