KEGG   Dechlorosoma suillum: Dsui_3052Help
Entry
Dsui_3052         CDS       T01657                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dsu  Dechlorosoma suillum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsui_3052
   01230 Biosynthesis of amino acids
    Dsui_3052
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsui_3052
   00051 Fructose and mannose metabolism
    Dsui_3052
   00562 Inositol phosphate metabolism
    Dsui_3052
Enzymes [BR:dsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dsui_3052
Exosome [BR:dsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dsui_3052
  Exosomal proteins of bladder cancer cells
   Dsui_3052
  Exosomal proteins of melanoma cells
   Dsui_3052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3266760..3267485)
Genome map
AA seq 241 aa AA seqDB search
MHGGLAANRSLLQGVVAGVKGLAAAVECAVCVPYPYLAQAQQELAKTEVSWGAQNLSEQV
SGAFTGEVSAAMLKDFGCRYVIVGHSERRALYGEDDGLVAKKFKQALAGGLVPILCVGET
LAQRESGQAAEVVAAQLDAVLDAAGVEVFAGAVVAYEPVWAIGTGLTASPAQAQAVHEGI
RARLAARNAEVAAGVRVLYGGSVKAGNAAELFAMPDIDGALVGGASLVAEEFVAICRAAA
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcatggcggcttggcagccaaccgttccctgctccagggtgtggttgccggggtgaag
gggcttgccgctgcggtcgagtgtgccgtttgtgttccctatccgtacctggctcaggcc
cagcaggagctggctaagactgaggtgagttggggggcgcaaaacctgagcgagcaggtc
tcgggggcatttaccggtgaggtaagtgcggcaatgctcaaggattttggctgtcgctat
gtcatcgtcggccactcggagcgccgggcgctctatggcgaggatgacgggctggtggca
aagaagttcaagcaggctctggcgggcgggttggtgccgattctgtgtgtcggtgaaacc
ctggctcagcgggagtccggtcaggcggctgaggtggttgctgctcagctggatgcggtc
ctggatgccgcgggtgttgaggttttcgccggagcggtggttgcctatgagcccgtgtgg
gccatcggtaccggcctcacggcctctcccgcccaggcccaggcggtgcatgaagggatt
cgtgcccgactggcggcaagaaatgcagaagtggctgccggagtgcgtgtgctctacggt
ggcagcgtcaaggcggggaatgcggcggagttgtttgccatgcccgatatcgacggggct
ttggtcggcggcgcatccctggtggcggaagaattcgtggccatttgtcgtgcggctgcc
ttttga

DBGET integrated database retrieval system