KEGG   Dechlorosoma suillum: Dsui_3191Help
Entry
Dsui_3191         CDS       T01657                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dsu  Dechlorosoma suillum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dsui_3191
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dsui_3191
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dsui_3191
Enzymes [BR:dsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dsui_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3425426..3426229)
Genome map
AA seq 267 aa AA seqDB search
MSRIQQTFDALKAQGKKALIPFITAGDPHPALTVTLLHTLVEAGADVIELGVPFSDPMAD
GPTIQRASERALAKGVSLRQVLAMVSEFREKDGETPIVLMGYANPIESMGMETFVAAAAE
AGVDGVLVVDYTPEESAAFCAAMNARDLDTIFLLAPTSTDARINQVGQLARGYVYYVSLK
GVTGSGALNFDEVAERIPKIREATGLPVGVGFGIRDAETAKRIAGMADAVVVGSRIIEEM
EKYPDDAVARVKGLVADIRRGVDAASK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcatccaacagactttcgacgcgctcaaggcccagggcaagaaggccctgatt
cccttcatcaccgccggcgatccccatccggccctcaccgtcaccctgctgcacaccctg
gtggaagccggcgccgacgtgatcgagctgggcgtgcccttctccgatcccatggccgat
ggccccaccatccagcgcgcctccgagcgagccctggccaagggcgtcagcctgcgccag
gtgctggccatggtcagcgagttccgcgagaaggacggcgagacccccatcgtcctcatg
ggctacgccaaccccatcgagtccatgggcatggagaccttcgtcgccgccgccgccgag
gccggtgtggacggcgtgctggtggtggactacaccccggaggaaagcgccgccttctgc
gccgccatgaacgcccgggacctggacaccatcttcctcctcgctcccacctccaccgac
gcccgcatcaatcaggtgggccagctggcccggggttacgtctattacgtttccctcaag
ggagtgaccggcagcggcgccctcaacttcgacgaagtggccgaacgcattcccaagatc
cgcgaagccaccggcctgcccgtgggcgtcggcttcggcatccgcgatgcggaaacggcc
aagcgcatcgccggcatggccgacgccgtggtggtgggcagccgcatcatcgaggaaatg
gaaaagtacccggatgacgccgtggcccgcgtaaaaggcctggtggccgacatccgccgc
ggtgtggatgccgccagcaagtaa

DBGET integrated database retrieval system