KEGG   Dechlorosoma suillum: Dsui_3261Help
Entry
Dsui_3261         CDS       T01657                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dsu  Dechlorosoma suillum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dsui_3261
   01230 Biosynthesis of amino acids
    Dsui_3261
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsui_3261
   00030 Pentose phosphate pathway
    Dsui_3261
   00051 Fructose and mannose metabolism
    Dsui_3261
   00052 Galactose metabolism
    Dsui_3261
  Energy metabolism
   00680 Methane metabolism
    Dsui_3261
Enzymes [BR:dsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dsui_3261
Protein phosphatases and associated proteins [BR:dsu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dsui_3261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3501266..3502534)
Genome map
AA seq 422 aa AA seqDB search
MAVKNAFYAQSGGPTAVINASACAVIETARAHPDKIGKVFAGRNGIVGALTEDLIDTSLE
SPADIARLRTTPGAAFGSCRYKLKSIEEHRAQYERLIEVCRAHDIGYFFYNGGNDSMDTA
WKVSQLSEKMGHPLICVGVPKTVDNDLPLTDCCPGFGSVAKYVATSIREAGLDVASMART
STKIFVLEVMGRHAGWITAACGLASGAGTDSGQPPHILLFPEVPFDEAAFLARVQQCVDR
YDYCTIAVSEGLKTADGKFVSEQGGKDAFGHSQLGGAGQWIAQLIKDKLGHKYHWALADY
LQRAARHIASKTDADQAYALGKAAVELAVAGRNAVMPTVVRLADAPYRWEVGVAELKDVA
NVERKMPADFISADGFHITDKCRAYLAPLIEGEDYPPYRHGLPDYVSLKNIAVPRQLGEF
KV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaaaaacgccttctacgcccagtccggcgggcccaccgccgtgatcaacgcc
tccgcctgcgccgtcatcgagacggcgcgggcccatccggacaaaatcggcaaggtcttc
gccgggcgcaacggcatcgtcggcgccctcaccgaagacctgatcgacaccagcctggag
tcccccgcggacatcgcccggctgcgcaccaccccgggagccgccttcggctcctgccgc
tacaagctcaagtccatcgaagagcaccgggcccagtacgagcgcctgatcgaagtctgt
cgtgcccatgacatcggctacttcttctacaacggcggcaacgattccatggataccgcc
tggaaggtttcccagctgtccgagaagatgggccacccgctgatctgcgtcggcgtaccg
aagacggtggacaacgatctgcctctcactgactgctgtccgggcttcggctcggtggcc
aagtacgtcgccacctccatccgcgaagcggggctggacgtggcctccatggcccgcact
tccaccaagattttcgtcctcgaagtcatgggccgccatgccggctggatcaccgccgcc
tgtggcctggcttccggtgccgggaccgattccggccagccgccccacatcctgctgttc
cccgaagtgcccttcgacgaggccgccttcctggcccgggtgcagcagtgcgtggatcgc
tacgactactgcaccatcgccgtctccgaaggcctgaagacggccgacggcaagttcgtt
tccgagcagggcggcaaggatgccttcggccattcccaactgggtggcgccggccagtgg
atcgcccagctgatcaaggacaagctgggccacaagtaccactgggccctggccgactac
ctgcagcgggccgcccgccacatcgcctccaagaccgatgccgaccaggcctatgccctg
ggcaaggcggcggtggagctggccgtggccggccgcaatgcggtgatgcccaccgtggta
cgcctcgccgatgcgccctaccgctgggaagtgggcgtggccgaactgaaggacgtggct
aatgtggagcgcaagatgccggcggatttcatcagcgccgacggcttccacatcaccgac
aagtgccgtgcctacctggcgcccctgatcgaaggggaggactatccgccctaccggcac
ggcctgcccgattacgtcagtctgaagaatattgccgtgccccggcagctgggagagttc
aaggtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system