KEGG   Dechlorosoma suillum: Dsui_3344Help
Entry
Dsui_3344         CDS       T01657                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dsu  Dechlorosoma suillum
Pathway
dsu00010  Glycolysis / Gluconeogenesis
dsu00030  Pentose phosphate pathway
dsu00051  Fructose and mannose metabolism
dsu00052  Galactose metabolism
dsu00230  Purine metabolism
dsu00500  Starch and sucrose metabolism
dsu00520  Amino sugar and nucleotide sugar metabolism
dsu00521  Streptomycin biosynthesis
dsu01100  Metabolic pathways
dsu01110  Biosynthesis of secondary metabolites
dsu01120  Microbial metabolism in diverse environments
dsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsui_3344
   00030 Pentose phosphate pathway
    Dsui_3344
   00051 Fructose and mannose metabolism
    Dsui_3344
   00052 Galactose metabolism
    Dsui_3344
   00500 Starch and sucrose metabolism
    Dsui_3344
   00520 Amino sugar and nucleotide sugar metabolism
    Dsui_3344
  Nucleotide metabolism
   00230 Purine metabolism
    Dsui_3344
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dsui_3344
Enzymes [BR:dsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dsui_3344
    5.4.2.8  phosphomannomutase
     Dsui_3344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEV27674
UniProt: G8QJZ5
Position
3582780..3584174
Genome map
AA seq 464 aa AA seqDB search
MNASVQIPALPPEIFKAYDIRGIVGKSLTADVVRAIGHGLGSLARERQQTAIAIGRDGRL
SGPELAGALADGIRAAGVDVIDIGCVPTPVTYFAAHHLGCHSCVSVTGSHNPPDYNGLKM
VIGGETLAGEAIQALKRRIEAGDLARGEGKLTQADVKAAYVERILADVKLARPMKIVMDC
GNGVAGAVAPELFKKLGCDIVPLFCEVDGTFPNHHPDPSKPENLADVIRALKETDAEIGI
AFDGDGDRLGVVTKDGEVIFPDRQLMLFAADVLSRVPGGEIVYDVKCTRLLAPWIREHGG
KPVMWQTGHALIKKKLKESGAPLAGEMSGHVFFKERWFGFDDGLYTGARLLEILARAADA
NPVLKGLPNATSTPELNIKMAEGEPFALLDKLKAGAKFEAAREIITIDGLRVEYADGFGL
ARPSNTTPVVVLRFEADNAEALARIQADFRRELAAAWPGLTLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttccgtccagattcccgccctgccccccgaaatcttcaaggcctacgacatc
cgcggcatcgtcggcaaaagcctcaccgccgacgtggtgcgcgccatcggccacggcctc
ggcagcctggcccgggagcggcagcagacggccatcgccatcggccgcgacggccgcctc
tccggccccgagctggccggggccctggctgacggcatccgcgccgccggggtggacgtg
atcgacatcggctgcgtgcccaccccggtcacctatttcgccgcccaccacctgggctgc
cactcctgcgtctccgtcaccggcagccacaatcccccggactacaacggcctgaaaatg
gtcatcggcggcgagaccctagccggcgaggcgatccaggccctgaagcgccgcatcgaa
gccggcgacctggcccggggcgaaggcaagctgacccaggccgacgtcaaggccgcctac
gtggaacgcatcctggccgacgtcaagctggcccgccccatgaagatcgtcatggattgc
ggcaacggcgtcgccggcgccgtggcgcccgagctgttcaagaaactcggctgcgacatc
gtgcccctcttctgcgaagtggacggcaccttccccaatcaccacccggacccctccaag
ccggagaatctggccgacgtcatccgcgccctgaaggagaccgacgccgagatcggcatc
gccttcgacggcgatggcgaccgcctgggggtagtgaccaaggacggcgaagtgatcttc
cccgaccgccagctgatgctcttcgccgccgacgtgctgtcccgcgtccccggcggcgag
atcgtctacgacgtcaaatgcacccgcctgctggccccctggatccgggaacacggcggc
aagccggtgatgtggcagaccggccacgccctgatcaagaaaaagctgaaggaatccggc
gcccccctggccggcgaaatgagcggccacgtcttcttcaaggagcgctggttcggcttc
gacgacggcctctacaccggcgcccgcctgctggaaatcctggcccgggccgccgacgcc
aacccggtgctgaagggcctgcccaacgccacctccaccccggagctgaacatcaagatg
gccgaaggcgagcccttcgccctgctggacaagctcaaggccggcgccaagttcgaggcc
gcccgggagatcatcaccatcgacggcctgcgggtggagtacgccgatggcttcggcctg
gcccgcccctccaataccacgccggtggtggtgctgcgcttcgaggccgacaacgccgag
gccctggcccgcatccaggccgacttccgccgcgaactggccgccgcctggcccggcctg
accctgcccttctga

DBGET integrated database retrieval system