KEGG   Dechlorosoma suillum: Dsui_3344Help
Entry
Dsui_3344         CDS       T01657                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dsu  Dechlorosoma suillum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsui_3344
   00030 Pentose phosphate pathway
    Dsui_3344
   00051 Fructose and mannose metabolism
    Dsui_3344
   00052 Galactose metabolism
    Dsui_3344
   00500 Starch and sucrose metabolism
    Dsui_3344
   00520 Amino sugar and nucleotide sugar metabolism
    Dsui_3344
  Nucleotide metabolism
   00230 Purine metabolism
    Dsui_3344
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dsui_3344
Enzymes [BR:dsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dsui_3344
    5.4.2.8  phosphomannomutase
     Dsui_3344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3582780..3584174
Genome map
AA seq 464 aa AA seqDB search
MNASVQIPALPPEIFKAYDIRGIVGKSLTADVVRAIGHGLGSLARERQQTAIAIGRDGRL
SGPELAGALADGIRAAGVDVIDIGCVPTPVTYFAAHHLGCHSCVSVTGSHNPPDYNGLKM
VIGGETLAGEAIQALKRRIEAGDLARGEGKLTQADVKAAYVERILADVKLARPMKIVMDC
GNGVAGAVAPELFKKLGCDIVPLFCEVDGTFPNHHPDPSKPENLADVIRALKETDAEIGI
AFDGDGDRLGVVTKDGEVIFPDRQLMLFAADVLSRVPGGEIVYDVKCTRLLAPWIREHGG
KPVMWQTGHALIKKKLKESGAPLAGEMSGHVFFKERWFGFDDGLYTGARLLEILARAADA
NPVLKGLPNATSTPELNIKMAEGEPFALLDKLKAGAKFEAAREIITIDGLRVEYADGFGL
ARPSNTTPVVVLRFEADNAEALARIQADFRRELAAAWPGLTLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcttccgtccagattcccgccctgccccccgaaatcttcaaggcctacgacatc
cgcggcatcgtcggcaaaagcctcaccgccgacgtggtgcgcgccatcggccacggcctc
ggcagcctggcccgggagcggcagcagacggccatcgccatcggccgcgacggccgcctc
tccggccccgagctggccggggccctggctgacggcatccgcgccgccggggtggacgtg
atcgacatcggctgcgtgcccaccccggtcacctatttcgccgcccaccacctgggctgc
cactcctgcgtctccgtcaccggcagccacaatcccccggactacaacggcctgaaaatg
gtcatcggcggcgagaccctagccggcgaggcgatccaggccctgaagcgccgcatcgaa
gccggcgacctggcccggggcgaaggcaagctgacccaggccgacgtcaaggccgcctac
gtggaacgcatcctggccgacgtcaagctggcccgccccatgaagatcgtcatggattgc
ggcaacggcgtcgccggcgccgtggcgcccgagctgttcaagaaactcggctgcgacatc
gtgcccctcttctgcgaagtggacggcaccttccccaatcaccacccggacccctccaag
ccggagaatctggccgacgtcatccgcgccctgaaggagaccgacgccgagatcggcatc
gccttcgacggcgatggcgaccgcctgggggtagtgaccaaggacggcgaagtgatcttc
cccgaccgccagctgatgctcttcgccgccgacgtgctgtcccgcgtccccggcggcgag
atcgtctacgacgtcaaatgcacccgcctgctggccccctggatccgggaacacggcggc
aagccggtgatgtggcagaccggccacgccctgatcaagaaaaagctgaaggaatccggc
gcccccctggccggcgaaatgagcggccacgtcttcttcaaggagcgctggttcggcttc
gacgacggcctctacaccggcgcccgcctgctggaaatcctggcccgggccgccgacgcc
aacccggtgctgaagggcctgcccaacgccacctccaccccggagctgaacatcaagatg
gccgaaggcgagcccttcgccctgctggacaagctcaaggccggcgccaagttcgaggcc
gcccgggagatcatcaccatcgacggcctgcgggtggagtacgccgatggcttcggcctg
gcccgcccctccaataccacgccggtggtggtgctgcgcttcgaggccgacaacgccgag
gccctggcccgcatccaggccgacttccgccgcgaactggccgccgcctggcccggcctg
accctgcccttctga

DBGET integrated database retrieval system