KEGG   Desulfitobacterium hafniense Y51: DSY0148Help
Entry
DSY0148           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00900  Terpenoid backbone biosynthesis
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DSY0148
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DSY0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N SWIM
Motif
Other DBs
NCBI-ProteinID: BAE81937
UniProt: Q251V5
Position
156698..157570
Genome map
AA seq 290 aa AA seqDB search
MIRNQVEMFAYAKINLALAITGRRPDGYHELESVMQSIGIYDRIRVTLAEGGIQCSCGEW
SGPENLAYRAAEAFLSGLGSSQGIHIDIEKNIPVQAGLGGGSADAAAALQALNKLFKEPY
TEEELKSFAAQLGADVAFCLKGGTQWATGVGEELKGLPHAPKINLVLIKPDQGVNTAEAY
RAFDQEGKFSHLDYAGWQEALASGRAESLIPLLYNDLEPASMKLLPEIAWVKEELMKQNG
CLGALMSGSGSAVFGIVQTEEQAEKIAAIWRERNYHVWVTHTMERGNIYG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaatcaggtcgaaatgttcgcctacgccaaaataaatcttgctctggctata
acaggccgtcgtcccgatgggtatcatgaattggaaagcgtcatgcaatccataggcatc
tatgatcggatacgggtgactttggcagaggggggaattcagtgctcctgcggagagtgg
agcggcccggagaatttggcttaccgggcggcggaagcttttttaagcggactgggaagc
agccagggtattcacattgacatcgagaagaatatccctgtccaagcgggattgggcggg
ggaagcgccgatgccgctgcggccttgcaggctctgaataagctttttaaagagccctat
actgaagaggaactgaagagctttgccgctcagctgggtgcggatgtggccttttgcctg
aaaggcgggacccaatgggcaaccggtgtgggtgaagaattaaaaggcctgcctcatgct
ccgaaaatcaaccttgttctcattaaacccgaccaaggggtaaatactgctgaagcctat
cgggcttttgatcaggaaggaaaattctctcatctggattatgccgggtggcaagaggct
ttggcatccgggagagcagaaagccttatccctcttctttataatgatttagagccggct
tctatgaagcttctgccggaaatagcctgggttaaagaagaattaatgaagcagaacggc
tgtctgggagctttgatgtccggcagcggctccgcagtgtttggaatcgttcaaactgaa
gaacaagcggaaaaaattgcagcgatatggcgggaaagaaactatcatgtctgggtaacg
catactatggaaaggggaaatatttatgggtag

DBGET integrated database retrieval system