KEGG   Desulfitobacterium hafniense Y51: DSY0148Help
Entry
DSY0148           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DSY0148
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DSY0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
156698..157570
Genome map
AA seq 290 aa AA seqDB search
MIRNQVEMFAYAKINLALAITGRRPDGYHELESVMQSIGIYDRIRVTLAEGGIQCSCGEW
SGPENLAYRAAEAFLSGLGSSQGIHIDIEKNIPVQAGLGGGSADAAAALQALNKLFKEPY
TEEELKSFAAQLGADVAFCLKGGTQWATGVGEELKGLPHAPKINLVLIKPDQGVNTAEAY
RAFDQEGKFSHLDYAGWQEALASGRAESLIPLLYNDLEPASMKLLPEIAWVKEELMKQNG
CLGALMSGSGSAVFGIVQTEEQAEKIAAIWRERNYHVWVTHTMERGNIYG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaatcaggtcgaaatgttcgcctacgccaaaataaatcttgctctggctata
acaggccgtcgtcccgatgggtatcatgaattggaaagcgtcatgcaatccataggcatc
tatgatcggatacgggtgactttggcagaggggggaattcagtgctcctgcggagagtgg
agcggcccggagaatttggcttaccgggcggcggaagcttttttaagcggactgggaagc
agccagggtattcacattgacatcgagaagaatatccctgtccaagcgggattgggcggg
ggaagcgccgatgccgctgcggccttgcaggctctgaataagctttttaaagagccctat
actgaagaggaactgaagagctttgccgctcagctgggtgcggatgtggccttttgcctg
aaaggcgggacccaatgggcaaccggtgtgggtgaagaattaaaaggcctgcctcatgct
ccgaaaatcaaccttgttctcattaaacccgaccaaggggtaaatactgctgaagcctat
cgggcttttgatcaggaaggaaaattctctcatctggattatgccgggtggcaagaggct
ttggcatccgggagagcagaaagccttatccctcttctttataatgatttagagccggct
tctatgaagcttctgccggaaatagcctgggttaaagaagaattaatgaagcagaacggc
tgtctgggagctttgatgtccggcagcggctccgcagtgtttggaatcgttcaaactgaa
gaacaagcggaaaaaattgcagcgatatggcgggaaagaaactatcatgtctgggtaacg
catactatggaaaggggaaatatttatgggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system