KEGG   Desulfitobacterium hafniense Y51: DSY0207Help
Entry
DSY0207           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DSY0207
Enzymes [BR:dsy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     DSY0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
224694..225593
Genome map
AA seq 299 aa AA seqDB search
MGKSLKGLLDALEPPKQRVLPCRGKDIVLGERTLIMGILNLTPDSFSDGGKFNTLERALK
QAEALVEQGADILDIGAESTRINHEPVSAEEEWERLEAVLKALLPRIAVPISVDTYKADV
AERALAAGVHMINDVWGLQKDPRMAEVVGRAQAPVIVMHNQEGSNYHHLMGDIMAYLKKS
IHLAEEQGLAGDQIIIDPGIGGTAFGKSLDIDLEIMSRLEEFRSLGRPILLGTSRKSMIG
QTLNLPTEERLEGTLATSVVGVAAGVDILRVHDVQANKRAVQMADAIYRRKRGENFSGS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaaaagcttaaagggtcttctggacgctctggaacctcctaagcaaagagttctc
ccctgtcgtgggaaggatattgtgttgggtgaacgcaccctgatcatggggatactcaac
cttactccggattccttttccgatggcggaaaattcaatactttggagcgtgccctaaag
caagcggaggccttggttgaacaaggggcggatattttggacatcggagcagagtccacc
cgcatcaatcacgagccggtcagtgccgaagaggaatgggagcgtctggaggctgtcctt
aaggctttgttgccacggattgctgttcccatttcggtggatacttataaagcagatgtg
gcagagagggcattggctgccggggtacatatgattaatgatgtctggggattgcaaaaa
gaccccagaatggcagaggtcgtggggagagctcaggcaccggtgattgtcatgcataat
caagagggaagcaactaccatcacctcatgggggatataatggcttacctgaaaaagagc
attcatcttgccgaggaacagggattagcaggtgatcagatcatcatcgatccgggcatt
ggcggaacagccttcggcaaaagtctggatatcgatctggaaatcatgagccgtctggaa
gaattccgctctttaggccgtcctatccttttggggacctcacggaaatccatgatcggt
caaaccctgaacctccccacggaggaacggttggaaggaaccctggctaccagcgtggta
ggcgtggccgccggggtggatattcttcgggttcatgatgtccaagccaataagagagcg
gttcagatggctgatgccatctatcgccgcaagagaggggagaactttagtggatcgtga

DBGET integrated database retrieval system