KEGG   Desulfitobacterium hafniense Y51: DSY0209Help
Entry
DSY0209           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DSY0209
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     DSY0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
225948..226421
Genome map
AA seq 157 aa AA seqDB search
MKAYLSIGSNLGDRGHYLQQSCQRLAEHPDVKIIKKSGTYETKPWGNVDQPDFWNQVLEI
ETSLAPLDLLNLCQEVEKSLGRERLIRWGPRTIDIDLLNYDNKVWEDERLILPHPRMEER
EFVLAPLREIAPHYILPSGKKVTEVCGDGEVWRLESK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgtatttgagtattggcagcaatctgggggaccgggggcattatttgcagcag
agctgtcaaaggctggcggaacacccggatgttaagatcatcaaaaagtccggcacgtat
gaaacaaagccctggggcaatgtggatcaaccggatttctggaatcaagtgctggagatt
gagacctcattagcgcctctggacctgttgaatctgtgtcaagaggttgaaaaatccctc
gggagagaaagacttattcgttgggggccaagaaccattgacattgacctcctaaattat
gataataaggtatgggaggacgaacggcttattctccctcatccccgcatggaagagcgg
gagtttgttctggcacccttacgggaaatagctccacactatatccttccttcaggaaaa
aaggttacagaagtttgtggagatggagaggtatggcgactggaatctaaataa

DBGET integrated database retrieval system