KEGG   Desulfitobacterium hafniense Y51: DSY0233Help
Entry
DSY0233           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DSY0233
Enzymes [BR:dsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     DSY0233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260717..261592
Genome map
AA seq 291 aa AA seqDB search
MSKETLMKMTESPGVFMGGETPYEEADAVILGIPMDYTVSFRPGTRLGPLSIRNVSIGIE
EYSVYLDKDLSDYAYCDCGDLSLPFGNVEKSLQVIEAAARQVVEDGKFPIFLGGEHLVTY
PLLKPFIEKYPELRVVHFDAHADLRTDYSGEPNSHATVMRKISEALGPHRVYQFGIRSGT
REEFLFAKEHNHLVVEEVLEPLKAVLPELKGKPVYVTLDIDVVDPAFAPGTGTQEAGGCT
SREIIKAVHALSELDVVGFDLVEVSPLMDTSERTALLAAKIVREAILSFVK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggagacgctcatgaagatgacagaaagccccggtgtgtttatgggaggagaa
accccttatgaagaggctgacgcagtaattttggggattcctatggattatacggtgagt
tttcgcccgggtacccgtttgggccccctgagtatccgcaatgtctccatcgggattgag
gaatatagtgtgtatctggataaggatctctctgattatgcttattgcgattgtggagat
ttaagcctgccctttggcaatgttgaaaaatctttgcaagtgatcgaagcggctgcccgg
caggtggtagaagacgggaaatttcccattttcttagggggagaacacctggttacctat
cctttgcttaaacccttcattgagaagtatcctgagctccgggtggtgcattttgacgcc
catgccgatttgcgtacagattactccggtgagcctaattcccatgctacggtgatgcgc
aaaatctcggaagctctggggccccaccgggtctaccagtttggcatacgctccggaacc
cgggaggaattcctttttgctaaggaacacaatcatttggtggtagaagaggttttggag
cccctcaaggctgtcctgccggagcttaaagggaagccggtctatgtgacgctagatatt
gatgtggtggatccggcctttgccccaggcactgggactcaggaagccggtggatgtact
tcccgggaaatcatcaaagccgttcatgccctcagtgagctggatgtggtgggctttgat
ctggtggaagtatcccctcttatggacaccagtgagcgtacggctcttttagcagcgaag
atcgtaagggaagcaattttgagttttgtaaaataa

DBGET integrated database retrieval system