KEGG   Desulfitobacterium hafniense Y51: DSY0261Help
Entry
DSY0261           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    DSY0261
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     DSY0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292286..294184
Genome map
AA seq 632 aa AA seqDB search
MEKGLFKKIVLSLAGLLVGLVIAVYLSAQLNPEAEAAAAFGGKNISVDGVPDDVVQAALK
TYVPPGQLDEYYMFASGGHSGNVFVYGVPSMRRIRTIPVFTPESAVGYGWTTESKEMLGE
WSWGDVHHPALSETKGDYDGRWLFVNDNANSRAARIDLDSFRTSQILDIPNIYGPHSAVF
MTPNSEYFMLGSRFAGPIPYGTYSPIENLSKDYNCVLAAVAIDPNNGEMSVGWEVLMPPW
SFDLSDAGKLDSEGWAFLTTYNTEEAYELLEVNASQREMDYVVALNWKMLEQAANEGKYK
IVDGVKMIDPLDVPGSVYLVPAMKSPHGVDVTPDGKYFIANGKVAPVATVFSFEKFKECI
DNKDFQGEERGFPVVNYEKVRVAEVPVGLGPLHTQFDGNGYAYTTLFIDSTIAKWSLDTF
EVVDVTPVHYCPGHLCAAEGDTVSPDGKYLVSLNKLAKDKFLSVGPSHPESAQLIDLTTD
KMKILMDVPTDPEPHFAQMIKADKITTWEVFEKDPSQPGAVYEKENARIERDGNNVTVYQ
MGFRSRYYPDHVEVNEGDHVTWYLTNTDFDEDITHGFGICLYDLNAEAQPGETIKFEFVA
DKAGVYPFYCTNFCSALHQEMQGWFIVKPKGL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaaggactgtttaagaagattgtattgtccctggcagggctgctggttggcctg
gtcatagctgtttacttatccgcccagcttaatcccgaggcggaggcggctgctgccttc
ggcgggaaaaatatatctgtggacggagtgcctgacgatgtggtgcaggcggctctgaaa
acctatgtgccacccggtcagctggatgagtattatatgtttgcctcagggggccattcc
ggtaatgtcttcgtctatggtgtgccatccatgcggcggattagaacaattccggtattt
acccccgagtccgccgtggggtatggctggacgacggaatccaaggaaatgcttggcgaa
tggagctggggggatgtccatcatcctgctttgagcgagaccaagggagattatgacggg
cgctggctttttgtcaatgataatgccaacagcagggccgcccggatcgatctggattcc
ttcaggactagtcaaattttggatattcctaatatttatggaccccacagcgctgtattt
atgacacctaactccgaatactttatgctggggtcccgctttgccggaccgataccctat
gggacctattctcccattgagaatttatcaaaagattataattgtgttttagcagcagta
gctatcgaccccaataatggtgagatgagcgtggggtgggaagtgctgatgcccccctgg
tccttcgatttatcggatgccggtaagttggacagtgagggctgggcctttctgacaacc
tataatactgaggaggcctatgagctgctggaggtcaatgcctcccagcgggaaatggat
tatgtggtcgctttaaattggaaaatgcttgaacaggcggccaatgaaggaaaatacaaa
atagttgatggagtcaaaatgattgatcccctggatgtaccgggctccgtctacttggtc
ccggctatgaagagcccccatggtgtggatgtcacaccggatggaaagtattttattgct
aacggaaaagtggctccggtagctaccgtattcagctttgagaaattcaaggaatgcatt
gacaacaaagacttccagggcgaggaacgaggtttcccggttgtcaattacgagaaagta
agagtggcggaagtgccggtgggcttaggaccattgcatactcaatttgacggcaacggt
tatgcctataccaccttattcatcgacagtactattgccaaatggagtctggacaccttt
gaggttgtcgacgttactccggtacattattgcccgggtcatctgtgtgctgctgaggga
gacactgtctctccggacggcaagtatctggtctccttaaataagctggccaaggataag
ttcttgtccgttgggccatcccatcccgaaagcgcccagctgattgatttaaccacggat
aagatgaaaatcttaatggatgttcccacagatcctgagcctcacttcgctcagatgatt
aaagccgataagattacgacctgggaagtttttgagaaggatcccagtcagccgggtgct
gtttatgagaaagaaaatgcccgcattgaacgggatggcaacaatgtcacagtctatcaa
atgggcttccgcagccgctattacccggatcatgtggaggtcaatgaaggggatcatgtg
acctggtatttaaccaatacggatttcgatgaggatatcacccatggctttggtatttgt
ctgtatgaccttaatgcggaagcacaaccgggtgagacgataaaatttgaatttgtcgcc
gataaagcgggagtctatcctttctattgcaccaacttctgctcggccctccatcaggaa
atgcagggctggtttattgtcaaaccaaaaggcctataa

DBGET integrated database retrieval system