KEGG   Desulfitobacterium hafniense Y51: DSY0515Help
Entry
DSY0515           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00010  Glycolysis / Gluconeogenesis
dsy00620  Pyruvate metabolism
dsy00640  Propanoate metabolism
dsy00680  Methane metabolism
dsy00720  Carbon fixation pathways in prokaryotes
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01120  Microbial metabolism in diverse environments
dsy01130  Biosynthesis of antibiotics
dsy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY0515
   00620 Pyruvate metabolism
    DSY0515
   00640 Propanoate metabolism
    DSY0515
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DSY0515
   00680 Methane metabolism
    DSY0515
Enzymes [BR:dsy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DSY0515
Lipid biosynthesis proteins [BR:dsy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DSY0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAE82304
UniProt: Q250I8
Position
complement(577021..578952)
Genome map
AA seq 643 aa AA seqDB search
MEEKNLEALLEEDRQFIPSEEFHKNALIQSADIYEQGQSLGFWEEQAKQLSWLSPWEKTL
EWNPPFAQWFVGGKLNASANCLDRHLQDWHRNKAAIIFEGENGDSQVLTYQDLHREVSKF
ANVLKANGVNKGDRVTIYLPMIPEAVISMLACARIGAPHSVVFGGFSSEALRDRVIDAQA
KAVITSDGSFRRGNTIPLKDNTDIALDGVDCVEHVFVIQRTKQTVQMKEERDLWYHEEMA
KASPVCPAEPMDAEDMLFILYTSGTTGKPKGVVHTTGGYMVGVSTTHRWVFDLKEEDVYW
CTADVGWITGHSYIVYGPLANGATVLMYEGSPDYPNRDRFWEIVEKYKVTILYTAPTAIR
TFMKWGPQYPQSRDLSSLRLLGSVGEPINPEAWMWYYKYIGGERCPIVDTWWQTETGMIM
MTPLPGITSLKPGSCTVPFPGVRIEVVDSAGHPVPKGGGGYLAIKEPWPAMLRNIYGDPA
RFERTYFGNWPGVYFPGDGAKWDKDGYFWILGRVDDVINVSGHRIGTMEVESALVDHPSV
AEAAVIGKNHEVKGQALACFVTLKEGIEITPDLEDELKKHVAKKIGALARPDDIFFTAEL
PKTRSGKIMRRLLRDIAEGRAIGDTTTLADASVVNTLKANYQE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaagaatcttgaggctttgctggaagaggatagacagttcatccccagtgag
gaattccacaaaaacgcactcattcaaagcgcggatatctatgaacaaggtcaaagcctc
ggcttttgggaggaacaggctaaacaactctcctggttgagcccttgggaaaaaaccctg
gagtggaatcctcccttcgcccagtggtttgtcggcgggaaactcaacgcctccgccaac
tgtctggatcgccacctccaggattggcatcgcaataaagccgctattatcttcgaaggc
gaaaacggggacagccaggttcttacctaccaggatctccatcgtgaagtctccaaattc
gctaatgtcctcaaagccaatggggtgaacaaaggtgatcgggtcaccatctatctgccc
atgattccggaagctgtgatttccatgctggcttgcgcccggattggggctccccacagt
gtggtcttcggaggcttcagttcggaagctttgcgggatcgggtcattgatgctcaggcc
aaagccgtcatcacttccgatggcagcttccgccggggcaacaccatccccttgaaagat
aataccgatatcgctttggacggcgtggactgcgtggaacatgtctttgtcattcaacga
accaaacaaaccgtacaaatgaaggaagagcgggacctttggtatcatgaagaaatggcc
aaggcctccccggtgtgtccggcggagcccatggatgcagaagatatgctctttatcctc
tacaccagcggtaccacaggaaaacccaagggtgtagtccataccacggggggctatatg
gtaggggtatccaccacccatcgctgggtctttgatctcaaggaagaggatgtttactgg
tgcaccgcggatgtgggctggattaccggtcactcctatattgtctacggccccttggcc
aatggagccactgtccttatgtatgagggaagtcctgattatccgaaccgggatcggttc
tgggaaatcgtcgagaaatacaaagtcaccattctttataccgcacccaccgccatccgg
acctttatgaagtggggtccccaatatccccagagccgggatctatccagcctgcgcttg
ctgggctctgtgggtgaacccatcaatccggaagcctggatgtggtactacaaatacatc
ggcggggaacggtgccccatcgtggatacctggtggcaaaccgagacgggtatgattatg
atgacccctctgccgggaattacttccttaaagcccggttcctgtaccgtacctttccca
ggagtcagaatcgaagtggtggacagcgccggccatcccgtcccaaagggaggcggcggc
tacctggctatcaaggagccctggcctgctatgctgcgcaatatctacggagatccggcg
cgcttcgagcggacgtacttcggcaactggccgggagtctacttccccggtgatggcgcc
aagtgggataaggacggatatttctggatactgggccgggtggatgatgtcatcaacgtt
tctggtcaccggatcggcaccatggaagtggaaagcgctttagtggatcacccctctgtt
gccgaggctgccgttatcggtaaaaaccatgaagttaaagggcaggccctggcctgtttc
gtcactttaaaggaaggcatcgaaatcactcccgatctggaggacgaattaaagaaacat
gtggcaaagaagatcggagctctggcccggccggatgatatcttctttaccgccgaactg
cccaagacccgcagcggtaagatcatgcgccgcctcctcagagacattgccgagggacgt
gctatcggtgataccaccactttggccgatgcctctgtggtcaatacccttaaagccaat
taccaggagtaa

DBGET integrated database retrieval system