KEGG   Desulfitobacterium hafniense Y51: DSY0515Help
Entry
DSY0515           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DSY0515
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY0515
   00620 Pyruvate metabolism
    DSY0515
   00640 Propanoate metabolism
    DSY0515
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DSY0515
   00680 Methane metabolism
    DSY0515
Enzymes [BR:dsy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     DSY0515
Lipid biosynthesis proteins [BR:dsy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   DSY0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(577021..578952)
Genome map
AA seq 643 aa AA seqDB search
MEEKNLEALLEEDRQFIPSEEFHKNALIQSADIYEQGQSLGFWEEQAKQLSWLSPWEKTL
EWNPPFAQWFVGGKLNASANCLDRHLQDWHRNKAAIIFEGENGDSQVLTYQDLHREVSKF
ANVLKANGVNKGDRVTIYLPMIPEAVISMLACARIGAPHSVVFGGFSSEALRDRVIDAQA
KAVITSDGSFRRGNTIPLKDNTDIALDGVDCVEHVFVIQRTKQTVQMKEERDLWYHEEMA
KASPVCPAEPMDAEDMLFILYTSGTTGKPKGVVHTTGGYMVGVSTTHRWVFDLKEEDVYW
CTADVGWITGHSYIVYGPLANGATVLMYEGSPDYPNRDRFWEIVEKYKVTILYTAPTAIR
TFMKWGPQYPQSRDLSSLRLLGSVGEPINPEAWMWYYKYIGGERCPIVDTWWQTETGMIM
MTPLPGITSLKPGSCTVPFPGVRIEVVDSAGHPVPKGGGGYLAIKEPWPAMLRNIYGDPA
RFERTYFGNWPGVYFPGDGAKWDKDGYFWILGRVDDVINVSGHRIGTMEVESALVDHPSV
AEAAVIGKNHEVKGQALACFVTLKEGIEITPDLEDELKKHVAKKIGALARPDDIFFTAEL
PKTRSGKIMRRLLRDIAEGRAIGDTTTLADASVVNTLKANYQE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaagaatcttgaggctttgctggaagaggatagacagttcatccccagtgag
gaattccacaaaaacgcactcattcaaagcgcggatatctatgaacaaggtcaaagcctc
ggcttttgggaggaacaggctaaacaactctcctggttgagcccttgggaaaaaaccctg
gagtggaatcctcccttcgcccagtggtttgtcggcgggaaactcaacgcctccgccaac
tgtctggatcgccacctccaggattggcatcgcaataaagccgctattatcttcgaaggc
gaaaacggggacagccaggttcttacctaccaggatctccatcgtgaagtctccaaattc
gctaatgtcctcaaagccaatggggtgaacaaaggtgatcgggtcaccatctatctgccc
atgattccggaagctgtgatttccatgctggcttgcgcccggattggggctccccacagt
gtggtcttcggaggcttcagttcggaagctttgcgggatcgggtcattgatgctcaggcc
aaagccgtcatcacttccgatggcagcttccgccggggcaacaccatccccttgaaagat
aataccgatatcgctttggacggcgtggactgcgtggaacatgtctttgtcattcaacga
accaaacaaaccgtacaaatgaaggaagagcgggacctttggtatcatgaagaaatggcc
aaggcctccccggtgtgtccggcggagcccatggatgcagaagatatgctctttatcctc
tacaccagcggtaccacaggaaaacccaagggtgtagtccataccacggggggctatatg
gtaggggtatccaccacccatcgctgggtctttgatctcaaggaagaggatgtttactgg
tgcaccgcggatgtgggctggattaccggtcactcctatattgtctacggccccttggcc
aatggagccactgtccttatgtatgagggaagtcctgattatccgaaccgggatcggttc
tgggaaatcgtcgagaaatacaaagtcaccattctttataccgcacccaccgccatccgg
acctttatgaagtggggtccccaatatccccagagccgggatctatccagcctgcgcttg
ctgggctctgtgggtgaacccatcaatccggaagcctggatgtggtactacaaatacatc
ggcggggaacggtgccccatcgtggatacctggtggcaaaccgagacgggtatgattatg
atgacccctctgccgggaattacttccttaaagcccggttcctgtaccgtacctttccca
ggagtcagaatcgaagtggtggacagcgccggccatcccgtcccaaagggaggcggcggc
tacctggctatcaaggagccctggcctgctatgctgcgcaatatctacggagatccggcg
cgcttcgagcggacgtacttcggcaactggccgggagtctacttccccggtgatggcgcc
aagtgggataaggacggatatttctggatactgggccgggtggatgatgtcatcaacgtt
tctggtcaccggatcggcaccatggaagtggaaagcgctttagtggatcacccctctgtt
gccgaggctgccgttatcggtaaaaaccatgaagttaaagggcaggccctggcctgtttc
gtcactttaaaggaaggcatcgaaatcactcccgatctggaggacgaattaaagaaacat
gtggcaaagaagatcggagctctggcccggccggatgatatcttctttaccgccgaactg
cccaagacccgcagcggtaagatcatgcgccgcctcctcagagacattgccgagggacgt
gctatcggtgataccaccactttggccgatgcctctgtggtcaatacccttaaagccaat
taccaggagtaa

DBGET integrated database retrieval system