KEGG   Desulfitobacterium hafniense Y51: DSY0603Help
Entry
DSY0603           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dsy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
695338..695904
Genome map
AA seq 188 aa AA seqDB search
MQLIEQAKIREAVLMILEAIGEDPEREGLKDTPDRVARMYAEIFSGLAEDAGVYLECVFT
EEHEEMIVVKDIPFYSTCEHHLVPFIGKAHVAYIPAGGKVTGLSKLARVVESIARRPQLQ
ERLTREIADVIMKKLNPQGVAVVVEAEHLCMSMRGIKKPGSKTVTSAVRGLFRKSAKTRA
EFLSLIKT
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgatagaacaagcaaaaatcagggaagcagtactcatgattttagaagcaatc
ggagaagaccctgagcgggaagggcttaaggatacgcctgaccgggtagccaggatgtat
gctgagattttcagcgggttggcagaagatgcgggagtatatttggaatgtgtatttaca
gaagaacatgaagaaatgatcgtggtaaaggatattcctttttattcgacgtgtgaacat
cacctggttccttttatcggcaaggctcacgtcgcttatattcctgccggcggcaaagtc
accggactcagtaaactggccagagtggtggaaagtatcgccaggcgtccacagcttcag
gagcgcttaacccgggaaattgccgatgtcattatgaaaaagttaaatccccagggagtg
gccgtggttgtagaagctgagcatttatgcatgagtatgcggggcatcaaaaaaccaggc
tccaaaaccgtgacttccgcagtgcggggcctgttcaggaaaagtgccaaaaccagagcg
gaattcttatccttgattaaaacctag

DBGET integrated database retrieval system