KEGG   Desulfitobacterium hafniense Y51: DSY0623Help
Entry
DSY0623           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DSY0623
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY0623
  Lipid metabolism
   00071 Fatty acid degradation
    DSY0623
  Amino acid metabolism
   00350 Tyrosine metabolism
    DSY0623
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DSY0623
   00626 Naphthalene degradation
    DSY0623
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DSY0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722385..723491
Genome map
AA seq 368 aa AA seqDB search
MEFRYFMPTEIYFGEDVVLKHQEVFKTIGSKALIVTGRSSAKNNGSYDEVTKALSETGVE
YILFDEVEQNPSLETIEKAGAIGKANKADFVIGIGGGSPMDAAKAIAVFIKNPEITKDNI
FSGQKLASIPVVVVATTAGTGSEVTQYSIITSNKERTKKNLGQRIFPKVAFLDCKYTYDL
PYDITVNTALDAFTHLVEGYLSSKSTPMSDIYGEKGFELFKDCFDRLLNNELDKEFRRKM
MLASTLAGMLISQSGTSLPHGMGYALTYHKGLPHGLANSILTMEYLKSFQDQRKIKKMLS
ILQLDDLTELEGIFKKLLKVRIEIAEEEIREYAKNFMANKDKLKNHPEAVELEDIVGIYY
RSLCEHRE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggagttcagatattttatgcccaccgaaatatattttggtgaagatgtggttttgaaa
catcaagaagtgtttaaaacaataggcagtaaggctttaattgtcacagggagaagttct
gcaaaaaacaatggttcctacgatgaagtgacgaaagccctttcagaaacaggagtagaa
tacattctctttgatgaagtagagcagaatccatctttagaaaccattgaaaaggctggt
gccataggtaaagcaaacaaggcggattttgtgataggcataggcggcggctcccctatg
gatgctgccaaagctatcgcagtatttataaagaatcctgaaatcactaaggataatatc
tttagcggccaaaagcttgccagcatccctgtggtcgtcgtggcaaccactgcagggaca
ggctcggaagtcactcaatacagtatcattacgtcaaacaaagaaaggacaaagaagaat
ttagggcaaaggattttccccaaagttgcctttttggactgcaaatatacctatgatttg
ccttatgatataacggttaataccgccttggatgcttttacccatttagtggaaggatat
ttaagctctaaaagtacgcccatgtctgatatctatggtgaaaaggggtttgaattattt
aaagactgctttgatagattactcaataatgaactggataaagaattccgcaggaagatg
atgctggcatcaaccttggctggaatgctcatatcccaaagtggcacttccctgccccat
gggatgggttatgcccttacttatcataaggggctgccccatggactggcgaatagtatt
ttaacaatggagtatttgaaatccttccaggatcaaagaaagattaaaaaaatgctgagc
attttgcagctggatgacttgacagaactggaaggaatctttaaaaaattgctcaaggta
aggattgagatagcagaggaagaaataagggagtatgcaaagaattttatggccaataag
gataagttgaaaaatcatcccgaagcagtagagctggaagatattgtggggatttattac
aggagcctctgcgagcatagagaatga

DBGET integrated database retrieval system