KEGG   Desulfitobacterium hafniense Y51: DSY0747Help
Entry
DSY0747           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DSY0747
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DSY0747
Enzymes [BR:dsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     DSY0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899055..899960
Genome map
AA seq 301 aa AA seqDB search
MERRKVRIIGVPIDLGADRRGVDMGPSAIRYAGLHERLKKLGWEVEDVGNIDVPIAETRE
IKDPLLKYLPEISEVNQKLYPLVAQAIKEEVIPLIIGGDHSLGIGSLAGCAASGKQFGVI
WFDTHGDYNSMETTSSGNIHGMPLAVANGIGVKELTSIGGAARKIKEENTVIIGARDFDD
EERAMIRQSGITVFTMSDIDRLGMEAVVRQGLEIANRGTHGVHISFDLDVLDPSEAPGVG
TPVQGGMTYREAHLAMEMVADCRCLLSMDVVEVNPILDAQNKTAELAVGLISSAFGQKIY
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaagaaaggtgcgcatcataggagtgcctatcgacttaggagcggatcggaga
ggggtggatatgggtcccagtgctattcgctatgcgggtcttcatgagcgcttaaaaaag
ctgggctgggaagtggaggatgtgggtaatatcgatgtaccgatcgccgagacccgggaa
attaaagatcctctgctcaaatatcttcctgagatttcagaggtcaatcaaaagctctat
cccctggtggctcaagccattaaggaggaggtcattcccttaattatcgggggggatcac
agcttgggaataggctccttagcggggtgtgccgccagcggcaagcagtttggcgttatt
tggtttgatacccatggggattataattccatggaaaccacctccagcggcaatattcat
ggcatgccgttagctgtggccaatggtattggcgttaaggagttaaccagtattggcgga
gctgcccggaagatcaaggaagaaaacaccgtaattatcggggcccgggattttgacgat
gaagagcgggctatgatccgccaatccgggattacagtgtttaccatgagcgatattgac
cgcctgggtatggaggcggtggttcggcaagggctggaaatcgccaatcgaggtacccac
ggagtccatatcagctttgatctggatgttttggaccccagtgaagctcccggtgtggga
accccggttcagggtgggatgacctatcgggaagctcatttggctatggagatggtcgcc
gattgccgatgcctgttgagcatggatgtggtagaggtcaaccccattttggatgcacag
aataagaccgcggaattagcagtggggctcataagctcagcctttggacagaagatttat
ccgtga

DBGET integrated database retrieval system