KEGG   Desulfitobacterium hafniense Y51: DSY0747Help
Entry
DSY0747           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dsy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dsy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
899055..899960
Genome map
AA seq 301 aa AA seqDB search
MERRKVRIIGVPIDLGADRRGVDMGPSAIRYAGLHERLKKLGWEVEDVGNIDVPIAETRE
IKDPLLKYLPEISEVNQKLYPLVAQAIKEEVIPLIIGGDHSLGIGSLAGCAASGKQFGVI
WFDTHGDYNSMETTSSGNIHGMPLAVANGIGVKELTSIGGAARKIKEENTVIIGARDFDD
EERAMIRQSGITVFTMSDIDRLGMEAVVRQGLEIANRGTHGVHISFDLDVLDPSEAPGVG
TPVQGGMTYREAHLAMEMVADCRCLLSMDVVEVNPILDAQNKTAELAVGLISSAFGQKIY
P
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaagaaaggtgcgcatcataggagtgcctatcgacttaggagcggatcggaga
ggggtggatatgggtcccagtgctattcgctatgcgggtcttcatgagcgcttaaaaaag
ctgggctgggaagtggaggatgtgggtaatatcgatgtaccgatcgccgagacccgggaa
attaaagatcctctgctcaaatatcttcctgagatttcagaggtcaatcaaaagctctat
cccctggtggctcaagccattaaggaggaggtcattcccttaattatcgggggggatcac
agcttgggaataggctccttagcggggtgtgccgccagcggcaagcagtttggcgttatt
tggtttgatacccatggggattataattccatggaaaccacctccagcggcaatattcat
ggcatgccgttagctgtggccaatggtattggcgttaaggagttaaccagtattggcgga
gctgcccggaagatcaaggaagaaaacaccgtaattatcggggcccgggattttgacgat
gaagagcgggctatgatccgccaatccgggattacagtgtttaccatgagcgatattgac
cgcctgggtatggaggcggtggttcggcaagggctggaaatcgccaatcgaggtacccac
ggagtccatatcagctttgatctggatgttttggaccccagtgaagctcccggtgtggga
accccggttcagggtgggatgacctatcgggaagctcatttggctatggagatggtcgcc
gattgccgatgcctgttgagcatggatgtggtagaggtcaaccccattttggatgcacag
aataagaccgcggaattagcagtggggctcataagctcagcctttggacagaagatttat
ccgtga

DBGET integrated database retrieval system