KEGG   Desulfitobacterium hafniense Y51: DSY1413Help
Entry
DSY1413           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DSY1413
   01230 Biosynthesis of amino acids
    DSY1413
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY1413
   00030 Pentose phosphate pathway
    DSY1413
   00051 Fructose and mannose metabolism
    DSY1413
   00052 Galactose metabolism
    DSY1413
  Energy metabolism
   00680 Methane metabolism
    DSY1413
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DSY1413
Protein phosphatases and associated proteins [BR:dsy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DSY1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1658784..1659905
Genome map
AA seq 373 aa AA seqDB search
MEPIKGEQRDGQSEIRKLAILTGGGDCPGLNAVIRAAVKTACHRGIAVVGIQDGFRGAVE
GDFRPLELKDVSGILPRGGTILGTTNRDNPFAYPTQVGEERQVQDRSAEVMDRFKAEGID
ALIAIGGDGSLSIAWEFAKQGLKVVGVPKTIDNDLMCTDLTFGFQTAVATAQDALDRLHT
TAESHHRIMILEVMGRYAGWIALYAGVAGGADVILIPEIPYQLESIAEAVQRRARLGKHF
SIIVVAEGAKPLGGDMVVERTMSGRTDPIKLGGIGAKLAADLEKVTDMETRVTVLGHLQR
GGSPIAVDRVLSTRYGVAAVEAALAGDFGMMVALQGQDIVRVPMAEAVHKLKQVEPDDPV
LNAARSMGIEFGD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgatcaaaggagagcagcgggatggtcaatctgaaatcaggaagctggcgatc
ttgaccgggggcggagactgcccggggttgaatgcggtgattcgtgccgctgtaaaaaca
gcttgtcatcgcggtatagcggtggtgggaattcaagatggttttcggggagctgtggaa
ggggatttccgtcccttagagcttaaggatgtctccgggatcttaccccggggaggaacg
attctgggcaccaccaaccgggataatccctttgcctatcctacacaagtcggggaagaa
cggcaggttcaggatcgttccgctgaagtgatggacaggtttaaagcggaaggaattgat
gccctgattgcgattgggggtgatgggagcttaagcatcgcttgggaatttgccaagcaa
gggcttaaggtggtgggtgttcccaaaaccatcgataatgatctgatgtgcacggattta
acctttggctttcagactgctgtggctactgcccaggacgctttggaccggctccacacc
acggctgaatcccaccaccgcattatgatcttagaggtcatgggacgctacgccggttgg
atcgccctctatgccggagtggcagggggagcggatgtcatcttaatcccggaaattcct
tatcagctggagagtatcgctgaagctgtccagagacgggcccgtttaggcaagcacttc
agcatcattgtggtggctgaaggggctaaacccctgggcggagacatggttgtggaacgc
actatgtcagggagaacagatcccattaaattaggaggaatcggtgcaaagctggcggcg
gatttagagaaggtcaccgatatggagaccagggtgactgtgctgggacatttgcagcgg
ggagggtctcccatcgctgtggatcgggtgctgtccacacgctatggggtggctgccgtt
gaagccgctttggctggtgattttggcatgatggtcgccctgcaggggcaagacatcgtc
agagtgccaatggcagaagccgttcacaagctgaagcaggtggaacctgacgatcctgtc
ttaaatgccgcccgcagcatggggatcgaattcggggactaa

DBGET integrated database retrieval system