KEGG   Desulfitobacterium hafniense Y51: DSY1413Help
Entry
DSY1413           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY1413
   00030 Pentose phosphate pathway
    DSY1413
   00051 Fructose and mannose metabolism
    DSY1413
   00052 Galactose metabolism
    DSY1413
  Energy metabolism
   00680 Methane metabolism
    DSY1413
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DSY1413
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     DSY1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1658784..1659905
Genome map
AA seq 373 aa AA seqDB search
MEPIKGEQRDGQSEIRKLAILTGGGDCPGLNAVIRAAVKTACHRGIAVVGIQDGFRGAVE
GDFRPLELKDVSGILPRGGTILGTTNRDNPFAYPTQVGEERQVQDRSAEVMDRFKAEGID
ALIAIGGDGSLSIAWEFAKQGLKVVGVPKTIDNDLMCTDLTFGFQTAVATAQDALDRLHT
TAESHHRIMILEVMGRYAGWIALYAGVAGGADVILIPEIPYQLESIAEAVQRRARLGKHF
SIIVVAEGAKPLGGDMVVERTMSGRTDPIKLGGIGAKLAADLEKVTDMETRVTVLGHLQR
GGSPIAVDRVLSTRYGVAAVEAALAGDFGMMVALQGQDIVRVPMAEAVHKLKQVEPDDPV
LNAARSMGIEFGD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgatcaaaggagagcagcgggatggtcaatctgaaatcaggaagctggcgatc
ttgaccgggggcggagactgcccggggttgaatgcggtgattcgtgccgctgtaaaaaca
gcttgtcatcgcggtatagcggtggtgggaattcaagatggttttcggggagctgtggaa
ggggatttccgtcccttagagcttaaggatgtctccgggatcttaccccggggaggaacg
attctgggcaccaccaaccgggataatccctttgcctatcctacacaagtcggggaagaa
cggcaggttcaggatcgttccgctgaagtgatggacaggtttaaagcggaaggaattgat
gccctgattgcgattgggggtgatgggagcttaagcatcgcttgggaatttgccaagcaa
gggcttaaggtggtgggtgttcccaaaaccatcgataatgatctgatgtgcacggattta
acctttggctttcagactgctgtggctactgcccaggacgctttggaccggctccacacc
acggctgaatcccaccaccgcattatgatcttagaggtcatgggacgctacgccggttgg
atcgccctctatgccggagtggcagggggagcggatgtcatcttaatcccggaaattcct
tatcagctggagagtatcgctgaagctgtccagagacgggcccgtttaggcaagcacttc
agcatcattgtggtggctgaaggggctaaacccctgggcggagacatggttgtggaacgc
actatgtcagggagaacagatcccattaaattaggaggaatcggtgcaaagctggcggcg
gatttagagaaggtcaccgatatggagaccagggtgactgtgctgggacatttgcagcgg
ggagggtctcccatcgctgtggatcgggtgctgtccacacgctatggggtggctgccgtt
gaagccgctttggctggtgattttggcatgatggtcgccctgcaggggcaagacatcgtc
agagtgccaatggcagaagccgttcacaagctgaagcaggtggaacctgacgatcctgtc
ttaaatgccgcccgcagcatggggatcgaattcggggactaa

DBGET integrated database retrieval system