KEGG   Desulfitobacterium hafniense Y51: DSY1622Help
Entry
DSY1622           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
Organism
dsy  Desulfitobacterium hafniense Y51
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1880526..1881587)
Genome map
AA seq 353 aa AA seqDB search
MNNAQLSSAKEFLKQLSENSGVSGYEETLAPLVLAAFTPLADQVGQDALGNIYAHKKGTQ
GRYKIMLAAHMDEIGLMVKGIEPSGFLRFTPVGGVDQRTLLSQEVIVHGRKPVLGVIGST
PPHLMTAGEEKAVKAEQMGIDVGMTFEQIKEVIQVGDIITLRRNTLELLNHVLAGKSFDD
RAGVVVMKICLEELQRLQHAHDVIAVSTTQEEVGYRGATTSAYSLNPDLAIAIDVTHAST
PDTKGQVEKELGKGPAIALGPNIHPFVYEELVKAAKEARIPYQNHPVPGRSGTDAWAIQV
TQAGVPTGLVSIPLRYMHTSVETIDMQDVILTGKLLAYFIAGLPEDLEGRVCY
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttgaataacgcgcaattatccagcgcgaaggaatttctaaaacaactctcggaaaattcc
ggtgtatcaggatatgaggaaactcttgctcccttggtcctggcagcgttcaccccctta
gccgatcaggtcggccaggatgccttgggcaatatttatgcccacaaaaaggggacccag
gggcgctataaaatcatgctggccgcccatatggatgaaataggcctcatggtcaaaggg
atcgaacccagcggcttcctgcgctttaccccagtagggggtgtggatcagcgtaccctg
ctttcccaggaagtcatcgtccatggcagaaagcctgtcctgggggtcataggctccact
ccgccccatttaatgaccgcaggtgaagaaaaagccgtgaaagcagaacagatgggaatc
gatgtgggaatgacttttgagcagatcaaagaggtcattcaggtgggggatatcattacc
ctgcggcgcaatactttggaattactgaatcatgtcctggccggcaagtcctttgatgac
cgggccggagtggtcgttatgaaaatatgtctggaagaactgcaaaggctgcagcatgct
catgatgtcattgccgtcagcaccactcaggaagaggttggctatagaggggcaaccacc
agtgcctatagcttaaatccggatttggccatcgctatcgatgtcacccatgccagcact
ccggataccaaagggcaagtagaaaaagagttggggaaaggtccggccattgccctgggg
cccaatatccatcccttcgtctatgaagaattggttaaggcggccaaagaagcccgtatc
ccttatcaaaaccatcccgttccgggacgcagcggcacagatgcctgggctattcaggtg
acacaagccggtgtgcccacgggcttagtgtccatacctttacgctatatgcatacctct
gtggaaaccattgatatgcaggatgtgatcctgaccggaaaactgctggcctattttatc
gccggacttcctgaagatttggagggaagagtatgctactaa

DBGET integrated database retrieval system