KEGG   Desulfitobacterium hafniense Y51: DSY1662Help
Entry
DSY1662           CDS       T00333                                 

Gene name
ribD
Definition
diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase
Orthology
K11752  
diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:dsy00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928958..1930076
Genome map
AA seq 372 aa AA seqDB search
MGNGGDYMELDNHYMSRALELAALAMGRTSPNPLVGCVIVKDGVIVGEGYHQKAGTPHAE
VHALQAAGEHARGATAYVTLEPCSHFGKTPPCADALIKAGIQRVVVAMVDPNPLVSGQGI
TRLRAAGIQVDVGLKEKEARTLNKGFLKAMQTGLPFVLYKSALTLDGKIATESGDSKWVS
NEASRAYVHRLRDHFDVIMVGSETVRQDNPALNCRIDEGRDPVRLLVDGALQIPLQAAVL
ASSCTAPCLIATTASAPLDKLKALRALENVEVWQYDSPRYVPLKDLLGDLVKRGWNSVLL
EGGGGLAGSLLRAQLIDEVEFIYAPKLIGGKGPSPLSGLELPLMAQAIPLEFLEIDGGTG
DLRVRAKVNYAD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacggcggcgattacatggaacttgacaatcattacatgtcccgggctctggaa
ttggcagccctggctatgggcagaaccagtcccaatcccctggtgggatgtgtcatcgtt
aaggatggcgttattgtcggtgaaggatatcatcaaaaagccggcactccccatgccgaa
gttcacgctctgcaggcagccggagaacatgcccggggagccacagcctatgttacttta
gagccttgttcacatttcgggaaaacccctccctgtgccgacgcactgattaaggcggga
atccaacgcgtcgtcgtggctatggtggatcccaatcccttagtgagcggacaagggatc
acccgcttacgggcagccggcattcaggtcgatgtagggcttaaagaaaaggaagcccgg
accttaaacaagggctttctaaaggctatgcaaaccggccttccctttgtcctctacaaa
tcggctttaacccttgatggcaaaatagcgacggagtcaggagactccaaatgggttagc
aatgaagcctcccgtgcctatgtccaccggctgcgcgatcacttcgatgtgattatggtg
ggcagtgaaaccgtgcgccaggataatcctgctttgaattgccggattgacgaaggccgt
gatccggtgcgcttgctcgtggatggagcattgcaaattcctctgcaggccgccgtactt
gcttcctcctgtaccgccccctgtctcatcgccaccacggcctccgctcctttggataag
ctgaaggccttgcgggctctggagaatgtggaggtttggcagtatgattccccccgttat
gtccctttaaaagacctgctgggagatttagtcaaacggggttggaactctgtattgctg
gagggcggcggtgggctggccggctccctgctccgcgctcaacttatcgatgaagtggag
tttatctatgcgcccaagctcattggcggcaaaggtccttcccctctgagcggacttgag
cttcctttgatggcgcaggcgattcctttagaattcctggagatcgacgggggaaccgga
gatcttcgggtacgggccaaggtaaattatgccgattaa

DBGET integrated database retrieval system