KEGG   Desulfitobacterium hafniense Y51: DSY1662Help
Entry
DSY1662           CDS       T00333                                 

Gene name
ribD
Definition
diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase
Orthology
K11752  
diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    DSY1662 (ribD)
Enzymes [BR:dsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     DSY1662 (ribD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     DSY1662 (ribD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928958..1930076
Genome map
AA seq 372 aa AA seqDB search
MGNGGDYMELDNHYMSRALELAALAMGRTSPNPLVGCVIVKDGVIVGEGYHQKAGTPHAE
VHALQAAGEHARGATAYVTLEPCSHFGKTPPCADALIKAGIQRVVVAMVDPNPLVSGQGI
TRLRAAGIQVDVGLKEKEARTLNKGFLKAMQTGLPFVLYKSALTLDGKIATESGDSKWVS
NEASRAYVHRLRDHFDVIMVGSETVRQDNPALNCRIDEGRDPVRLLVDGALQIPLQAAVL
ASSCTAPCLIATTASAPLDKLKALRALENVEVWQYDSPRYVPLKDLLGDLVKRGWNSVLL
EGGGGLAGSLLRAQLIDEVEFIYAPKLIGGKGPSPLSGLELPLMAQAIPLEFLEIDGGTG
DLRVRAKVNYAD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacggcggcgattacatggaacttgacaatcattacatgtcccgggctctggaa
ttggcagccctggctatgggcagaaccagtcccaatcccctggtgggatgtgtcatcgtt
aaggatggcgttattgtcggtgaaggatatcatcaaaaagccggcactccccatgccgaa
gttcacgctctgcaggcagccggagaacatgcccggggagccacagcctatgttacttta
gagccttgttcacatttcgggaaaacccctccctgtgccgacgcactgattaaggcggga
atccaacgcgtcgtcgtggctatggtggatcccaatcccttagtgagcggacaagggatc
acccgcttacgggcagccggcattcaggtcgatgtagggcttaaagaaaaggaagcccgg
accttaaacaagggctttctaaaggctatgcaaaccggccttccctttgtcctctacaaa
tcggctttaacccttgatggcaaaatagcgacggagtcaggagactccaaatgggttagc
aatgaagcctcccgtgcctatgtccaccggctgcgcgatcacttcgatgtgattatggtg
ggcagtgaaaccgtgcgccaggataatcctgctttgaattgccggattgacgaaggccgt
gatccggtgcgcttgctcgtggatggagcattgcaaattcctctgcaggccgccgtactt
gcttcctcctgtaccgccccctgtctcatcgccaccacggcctccgctcctttggataag
ctgaaggccttgcgggctctggagaatgtggaggtttggcagtatgattccccccgttat
gtccctttaaaagacctgctgggagatttagtcaaacggggttggaactctgtattgctg
gagggcggcggtgggctggccggctccctgctccgcgctcaacttatcgatgaagtggag
tttatctatgcgcccaagctcattggcggcaaaggtccttcccctctgagcggacttgag
cttcctttgatggcgcaggcgattcctttagaattcctggagatcgacgggggaaccgga
gatcttcgggtacgggccaaggtaaattatgccgattaa

DBGET integrated database retrieval system