KEGG   Desulfitobacterium hafniense Y51: DSY1825Help
Entry
DSY1825           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DSY1825
Enzymes [BR:dsy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     DSY1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2113933..2114496)
Genome map
AA seq 187 aa AA seqDB search
MGMDLEKIEEAVTMILEAIGEDPRREGLLDTPKRVARMYQEVFAGLHEDPSQHLKVQFSE
DHEEMIIVKDIPVYSMCEHHLVPFYGKAHVAYIPRKGKVTGLSKIARVVEGYAKRPQLQE
RLTGQIADSVMSMLNARGVLVVIEAEHMCMTMRGVKKPGSMTLTSAVRGIFKTNEITRSE
GFALIKQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgggcatggatttagaaaaaatagaggaagcagtgaccatgattctggaagccattgga
gaagatccaaggcgggaaggattattggataccccgaaacgagtggccaggatgtatcag
gaggtttttgccggacttcatgaagaccccagtcagcatttaaaagtgcagttttctgaa
gatcatgaggagatgatcattgttaaggatattccggtttattccatgtgtgagcatcat
ctggttcctttttacgggaaagcccatgtagcttatataccacgtaaaggcaaagtgaca
ggtttatcaaaaattgcccgggttgtggaagggtatgcgaaacgtcctcaacttcaagaa
cgattaacaggacagattgccgattcggtgatgagcatgctcaatgcccgaggagtcctt
gtggtgatcgaagctgaacatatgtgcatgaccatgcggggagtcaaaaagccgggctcc
atgaccttaacctctgcagtccgcgggatatttaaaaccaatgaaatcactcgctcagaa
gggtttgcgttgattaagcaatga

DBGET integrated database retrieval system