KEGG   Desulfitobacterium hafniense Y51: DSY1839Help
Entry
DSY1839           CDS       T00333                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DSY1839
   01230 Biosynthesis of amino acids
    DSY1839
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSY1839
   00030 Pentose phosphate pathway
    DSY1839
   00051 Fructose and mannose metabolism
    DSY1839
   00052 Galactose metabolism
    DSY1839
  Energy metabolism
   00680 Methane metabolism
    DSY1839
Enzymes [BR:dsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DSY1839
Protein phosphatases and associated proteins [BR:dsy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DSY1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2131211..2132182)
Genome map
AA seq 323 aa AA seqDB search
MTNTVRKIAVLTSGGDAPGMNAAIRAVVRKGIYHGLEVLGIRKGYEGLIHGEFITMHLGA
VADIIHRGGTMLMTARSQEMLTPEGQKNAAAQLRYRGIDALIVIGGDGSFRGAQTLSAQG
IAIVGIPGTIDNDITGTDLTIGFDTAVNNVVQAVSKIRDTATSHDRTFLVEVMGRDCGNI
ALQSGVACGAESILVPEIEPDLDDIVAKLERGHQRGKHHSIIMVAEGAMSAWNLGEELRQ
RTGFETRVTILGHIQRGGNPSALDVVLASQMGGKAVEILCAGETDRMTACVNQEIQSLPL
EVAYGERKPFNKVLYDLANQLAI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataccgtcaggaagatcgctgttctcaccagcgggggggatgcgccgggaatg
aatgcggccattcgggcagtggttcgcaagggaatttatcatggacttgaggttttgggg
attcgcaaggggtatgaaggcctgattcatggggagttcataaccatgcatctgggagca
gtagcggatatcattcataggggcggtaccatgctcatgaccgcgcgttcccaggagatg
ctcaccccggagggacaaaaaaacgccgcggctcaattgcgttatcgcggcatcgatgcg
ctgattgtgatcgggggagacggttcttttcggggagcacagaccttgtctgctcaagga
atagccatcgtcggtataccgggtaccattgataacgatattaccggcacggatttaacc
atcggatttgatacagctgtcaataatgtggttcaagcagtcagcaaaatccgggatacg
gcaacatcccatgatcgaacctttttagtagaagtcatgggacgggattgcggtaacatc
gccttgcaatccggcgtagcctgcggtgcagaatccatccttgtgccggaaatcgaaccg
gatctggatgatattgtcgcgaaattggaacgcggccaccagcggggcaaacatcacagt
atcattatggtggcagaaggggctatgagtgcttggaatctgggggaagaactccgtcag
agaaccggctttgaaacccgggtcaccatcttaggccatatccaaaggggcggcaatcca
agtgccctcgatgtggtcctggcctcgcaaatgggcggaaaagcagtggagatactctgc
gccggggaaaccgatcggatgacagcctgtgtcaaccaggaaatccaatccctgcctttg
gaggtggcttatggtgagcgcaaacccttcaacaaagttctctatgatctggccaatcaa
ttggctatctga

DBGET integrated database retrieval system