KEGG   Desulfitobacterium hafniense Y51: DSY1894Help
Entry
DSY1894           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DSY1894
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DSY1894
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DSY1894
Enzymes [BR:dsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DSY1894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2188521..2190005)
Genome map
AA seq 494 aa AA seqDB search
MLYESTRGNFPDQTGKEAIALGMVPVGGLFVPKELPQIHWEEVRGISYPELAQLIFKRYL
PDFPEEKCVETSKIYTDGVFDSDNPAPLVNVGDMGILELWHGPTAAFKDMALQALPHLLG
ESMQVLTHTDKVLILVATSGDTGKAALEGFKNVEGTEIMVFYPEHGVSTVQEQQMTTTDG
VNTKVVPVVGNFDQCQSAVKEIFGNPDLREKFKEQGIAFSSANSINWGRLLPQIIYYYWA
YLQGVESQRIRPGEKMNVVVPTGNFGNILAAYYAKEMGLPIHQLICASNENNVLTDFFSQ
GVYNRKRPFFVTSSPSMDILISSNFERFLYEVSGRDGSKVGKWYDDLQALGEFTVDSDTL
AKARKAVIAGWAGEADVLAVIQSVYKEHAYVLDPHTAVAVKVYQDYLRESGDNTFTMIAS
TASPFKFAKTVLEGIDADALEDDEWANLRKLREITGWSIPKGLQGLEDKETFGLEPVQPE
EIPELIQKVYIPNR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacgaaagcacgagagggaatttccctgatcaaactggaaaagaagcgattgcc
ttgggcatggttccggtaggggggttatttgttccgaaagaacttccgcaaattcactgg
gaggaagttcgcggcatttcctatccagaactggcccaattgatttttaaacgctatcta
cccgattttccggaggagaaatgtgttgagacttcaaaaatatacacggatggagttttc
gattcggataatccggctcccctggtgaatgtgggagatatgggaatactggagctatgg
catggtcctactgccgccttcaaagatatggccttgcaggctttgccccatcttttggga
gaaagcatgcaggttctcactcacaccgacaaggtgctgattttggtcgctacgtcagga
gatacgggaaaggccgccctggagggatttaaaaatgttgagggtacagagatcatggtc
ttttatcctgaacatggagtgagcactgttcaggagcagcaaatgaccacaactgatggg
gtcaacactaaagtagttcccgtcgtcggtaatttcgatcagtgtcagtccgctgtgaaa
gagatttttggcaatcctgacttaagagaaaaatttaaagaacagggcattgccttttct
tcggcaaactctattaactggggaaggcttttgccgcaaatcatctattactattgggct
tatttacaaggggtggaatcgcaacgaattcgtcccggagaaaaaatgaatgtggtggta
cccacagggaacttcggcaacattcttgccgcttattatgccaaggaaatgggattgcct
attcatcaactcatttgtgcctccaatgagaataatgtgctgacagatttcttcagccaa
ggagtgtataaccgcaagcgtccttttttcgtgacctcttctccttcgatggatatttta
atatccagtaattttgagcgcttcctttacgaagtttccgggagggatgggtcaaaggta
ggaaagtggtatgacgacctgcaggcccttggcgaatttactgtggattcggatacttta
gccaaggccaggaaagcagtcattgccggatgggccggtgaggcggatgtgctggcggtc
atacaatccgtatataaagagcatgcctatgttctggatccccatacagccgtagcggtg
aaagtatatcaagattatcttcgggaatcaggagacaacacctttaccatgatcgcctca
acagccagtccctttaaatttgccaaaaccgtcttagagggcattgatgcagatgcctta
gaagatgatgaatgggcgaatttgcggaagctgagggagattaccggctggagcataccc
aaaggtctccaggggttagaggataaagagactttcggtttggagccggtacaacctgag
gagattccggaactcatccagaaggtttatatacccaatagatag

DBGET integrated database retrieval system