KEGG   Desulfitobacterium hafniense Y51: DSY1926Help
Entry
DSY1926           CDS       T00333                                 

Definition
(GenBank) hypothetical protein
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dsy  Desulfitobacterium hafniense Y51
Pathway
dsy00020  Citrate cycle (TCA cycle)
dsy00640  Propanoate metabolism
dsy00660  C5-Branched dibasic acid metabolism
dsy00720  Carbon fixation pathways in prokaryotes
dsy01100  Metabolic pathways
dsy01110  Biosynthesis of secondary metabolites
dsy01120  Microbial metabolism in diverse environments
dsy01130  Biosynthesis of antibiotics
dsy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DSY1926
   00640 Propanoate metabolism
    DSY1926
   00660 C5-Branched dibasic acid metabolism
    DSY1926
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DSY1926
Enzymes [BR:dsy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DSY1926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2 GARS_A Citrate_bind ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAE83715
UniProt: Q24W77
Position
complement(2222209..2223486)
Genome map
AA seq 425 aa AA seqDB search
MARFLEYQGKEWLAKAGMPVPKGRPASTPEEAREAAEWIGGPVAVKGQVQAGGRGKAGIV
KLVNTPDEAAAAAAEILSKTVKGLPVRKVLVEEKLDIKKEFYCSFVVNGAKEARSPMLMF
SVEGGMDIESVPEDKLLKINVDPINGLQTYDAVDLAAKAGIAPEELTKFAKFLTKLSQTY
KKYDCMTLEINPFVMTGNGNLICADCKMEIDNSSVGRHPEFGFDIARDLPGEPTELDYIG
WSIEETDARGTGFLMNMGYDEVSPGYVGYHPIGGGSAMMGLDALNQVGLKPANYADTSGN
PVASKIYRVAKSVLSQPNIDGYLLGGFMMANQEQWHHAHAIVKVLREILPTQKPGLPCVL
LLCGNREDESLEILKTGLADLMTSDGPGKRIEIYGKEYVTDTKFIGERLLALSKDYRAEK
EAQGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttctagagtatcaaggtaaagaatggcttgcaaaagcaggaatgccggta
cctaagggtcgtccggcatcgacccccgaagaagcaagggaagccgctgaatggattggc
ggccctgttgcggtaaaaggtcaggtacaagcgggtggtcgtggtaaagctgggattgtt
aaactggttaacactcccgatgaggcagcagcagctgctgctgaaattctctccaaaaca
gtaaaaggcttaccggtgcgcaaagttcttgtggaagaaaaattggatatcaaaaaagag
ttctattgctcctttgtcgttaacggagcaaaggaagcccgttcaccaatgcttatgttc
agcgttgagggcggtatggatattgaaagtgtcccggaagacaaattactgaagatcaat
gtggaccccatcaatggactgcagacttatgatgcggtagatttggctgctaaagcagga
atagctccggaagaattaacgaagtttgctaaatttttgacgaaactttctcaaacttat
aagaaatacgactgtatgacccttgagatcaaccccttcgttatgacagggaatggcaat
ctcatctgtgccgactgcaagatggaaatcgacaacagttccgtaggccgtcatcccgag
ttcggctttgacatcgcccgcgacctgcctggtgagcccacagagttggactacatcggc
tggagcattgaggaaaccgatgcccgtggcacaggcttccttatgaatatgggatacgat
gaagtcagccccggatatgttggctatcatcccatcggcggcggttcggcgatgatgggc
ttggatgctcttaatcaagtaggtctgaagccggccaactatgccgacaccagcggcaac
cccgtagcttccaaaatttatcgcgttgccaaatcggtgctttcccagcccaatattgac
ggctacctccttgggggctttatgatggccaaccaggaacaatggcatcatgctcatgct
atagtcaaagtgcttcgtgaaatcctccccactcaaaaaccaggattgccttgtgtgctc
ctgctttgcggcaaccgggaagatgaatctttggaaattctcaaaaccggactggctgat
ctgatgaccagcgatggacctggaaagagaattgagatttacggcaaagaatatgtaacc
gatacgaagttcattggtgaaagacttttagctctgagcaaagactatcgggctgagaaa
gaagctcaaggaaagtag

DBGET integrated database retrieval system